BLASTX nr result
ID: Angelica27_contig00031140
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00031140 (249 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KZM95826.1 hypothetical protein DCAR_019068 [Daucus carota subsp... 53 3e-06 XP_017250322.1 PREDICTED: shugoshin-1 [Daucus carota subsp. sati... 53 3e-06 >KZM95826.1 hypothetical protein DCAR_019068 [Daucus carota subsp. sativus] Length = 416 Score = 53.1 bits (126), Expect = 3e-06 Identities = 25/35 (71%), Positives = 26/35 (74%) Frame = +2 Query: 143 MSMKENICALNSNKGTIPLDNEKPRVRKSAGVFGS 247 MSM EN+CA NS K IP NEKPRVRKS VFGS Sbjct: 1 MSMNENLCAFNSTKSVIPPGNEKPRVRKSTEVFGS 35 >XP_017250322.1 PREDICTED: shugoshin-1 [Daucus carota subsp. sativus] Length = 428 Score = 53.1 bits (126), Expect = 3e-06 Identities = 25/35 (71%), Positives = 26/35 (74%) Frame = +2 Query: 143 MSMKENICALNSNKGTIPLDNEKPRVRKSAGVFGS 247 MSM EN+CA NS K IP NEKPRVRKS VFGS Sbjct: 1 MSMNENLCAFNSTKSVIPPGNEKPRVRKSTEVFGS 35