BLASTX nr result
ID: Angelica27_contig00030992
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00030992 (569 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017217812.1 PREDICTED: uncharacterized protein LOC108195362 [... 54 6e-06 >XP_017217812.1 PREDICTED: uncharacterized protein LOC108195362 [Daucus carota subsp. sativus] Length = 130 Score = 53.5 bits (127), Expect = 6e-06 Identities = 27/41 (65%), Positives = 33/41 (80%) Frame = -3 Query: 537 EKVKQVEAEVDEQVNKKVQQNLAWVLKKLGKAKQTCIRLLE 415 EKVK+++ EVDEQVN+KVQQNLA VLKKLG+A I + E Sbjct: 69 EKVKKIQEEVDEQVNRKVQQNLASVLKKLGEANPFTIDVTE 109