BLASTX nr result
ID: Angelica27_contig00030968
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00030968 (536 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AHZ96979.1 NAC transcription factor N, partial [Saccharum hybrid... 59 1e-08 AHZ96978.1 NAC transcription factor M, partial [Saccharum hybrid... 60 3e-08 AHZ96980.1 NAC transcription factor O, partial [Saccharum hybrid... 58 5e-08 EYU23774.1 hypothetical protein MIMGU_mgv1a007138mg [Erythranthe... 62 5e-08 EYU23773.1 hypothetical protein MIMGU_mgv1a007138mg [Erythranthe... 62 5e-08 XP_012853700.1 PREDICTED: NAC domain-containing protein 89-like ... 62 6e-08 XP_012853699.1 PREDICTED: NAC domain-containing protein 68-like ... 62 6e-08 XP_011099748.1 PREDICTED: uncharacterized protein LOC105178089 [... 61 1e-07 CDP04701.1 unnamed protein product [Coffea canephora] 60 1e-07 XP_014660428.1 PREDICTED: NAC domain-containing protein 82-like ... 60 3e-07 KXG22035.1 hypothetical protein SORBI_009G143700 [Sorghum bicolo... 58 1e-06 XP_008656268.1 PREDICTED: NAC domain-containing protein 55-like ... 58 1e-06 OEL17627.1 NAC domain-containing protein 82 [Dichanthelium oligo... 58 1e-06 XP_008649658.1 PREDICTED: uncharacterized protein LOC103630378 [... 58 1e-06 JAT54620.1 NAC domain-containing protein 78, partial [Anthurium ... 58 1e-06 ONM15752.1 ras-related protein18A1, partial [Zea mays] 57 2e-06 ALC79002.1 NAC transcription factors 25 [Manihot esculenta] 57 2e-06 ONM15759.1 ras-related protein18A1 [Zea mays] 57 2e-06 ALC78988.1 NAC transcription factors 11 [Manihot esculenta] OAY3... 57 2e-06 ALC78986.1 NAC transcription factors 9 [Manihot esculenta] OAY36... 57 2e-06 >AHZ96979.1 NAC transcription factor N, partial [Saccharum hybrid cultivar CoC 671] Length = 89 Score = 59.3 bits (142), Expect = 1e-08 Identities = 26/33 (78%), Positives = 29/33 (87%) Frame = +1 Query: 436 VMARMSLPPGFRFYPTDVEATMYYLKRKVMGKK 534 VMA+ SLPPGFRF+PTDVE YYLKRK+MGKK Sbjct: 2 VMAQTSLPPGFRFHPTDVELVSYYLKRKIMGKK 34 >AHZ96978.1 NAC transcription factor M, partial [Saccharum hybrid cultivar CoC 671] Length = 135 Score = 59.7 bits (143), Expect = 3e-08 Identities = 27/39 (69%), Positives = 31/39 (79%) Frame = +1 Query: 418 GRLKTFVMARMSLPPGFRFYPTDVEATMYYLKRKVMGKK 534 G+ VMA+ SLPPGFRF+PTDVE YYLKRK+MGKK Sbjct: 23 GKRSFRVMAQTSLPPGFRFHPTDVELVSYYLKRKIMGKK 61 >AHZ96980.1 NAC transcription factor O, partial [Saccharum hybrid cultivar CoC 671] Length = 89 Score = 57.8 bits (138), Expect = 5e-08 Identities = 25/32 (78%), Positives = 28/32 (87%) Frame = +1 Query: 439 MARMSLPPGFRFYPTDVEATMYYLKRKVMGKK 534 MA+ SLPPGFRF+PTDVE YYLKRK+MGKK Sbjct: 1 MAQTSLPPGFRFHPTDVELVSYYLKRKIMGKK 32 >EYU23774.1 hypothetical protein MIMGU_mgv1a007138mg [Erythranthe guttata] Length = 412 Score = 61.6 bits (148), Expect = 5e-08 Identities = 28/32 (87%), Positives = 29/32 (90%) Frame = +1 Query: 439 MARMSLPPGFRFYPTDVEATMYYLKRKVMGKK 534 MAR SLPPGFRF+PTDVE MYYLKRKVMGKK Sbjct: 1 MARTSLPPGFRFHPTDVELIMYYLKRKVMGKK 32 >EYU23773.1 hypothetical protein MIMGU_mgv1a007138mg [Erythranthe guttata] Length = 418 Score = 61.6 bits (148), Expect = 5e-08 Identities = 28/32 (87%), Positives = 29/32 (90%) Frame = +1 Query: 439 MARMSLPPGFRFYPTDVEATMYYLKRKVMGKK 534 MAR SLPPGFRF+PTDVE MYYLKRKVMGKK Sbjct: 1 MARTSLPPGFRFHPTDVELIMYYLKRKVMGKK 32 >XP_012853700.1 PREDICTED: NAC domain-containing protein 89-like isoform X2 [Erythranthe guttata] Length = 440 Score = 61.6 bits (148), Expect = 6e-08 Identities = 28/32 (87%), Positives = 29/32 (90%) Frame = +1 Query: 439 MARMSLPPGFRFYPTDVEATMYYLKRKVMGKK 534 MAR SLPPGFRF+PTDVE MYYLKRKVMGKK Sbjct: 1 MARTSLPPGFRFHPTDVELIMYYLKRKVMGKK 32 >XP_012853699.1 PREDICTED: NAC domain-containing protein 68-like isoform X1 [Erythranthe guttata] Length = 554 Score = 61.6 bits (148), Expect = 6e-08 Identities = 28/32 (87%), Positives = 29/32 (90%) Frame = +1 Query: 439 MARMSLPPGFRFYPTDVEATMYYLKRKVMGKK 534 MAR SLPPGFRF+PTDVE MYYLKRKVMGKK Sbjct: 1 MARTSLPPGFRFHPTDVELIMYYLKRKVMGKK 32 >XP_011099748.1 PREDICTED: uncharacterized protein LOC105178089 [Sesamum indicum] Length = 564 Score = 60.8 bits (146), Expect = 1e-07 Identities = 27/32 (84%), Positives = 29/32 (90%) Frame = +1 Query: 439 MARMSLPPGFRFYPTDVEATMYYLKRKVMGKK 534 MAR SLPPGFRF+PTDVE MYYLK+KVMGKK Sbjct: 1 MARTSLPPGFRFHPTDVELVMYYLKKKVMGKK 32 >CDP04701.1 unnamed protein product [Coffea canephora] Length = 500 Score = 60.5 bits (145), Expect = 1e-07 Identities = 27/32 (84%), Positives = 28/32 (87%) Frame = +1 Query: 439 MARMSLPPGFRFYPTDVEATMYYLKRKVMGKK 534 M R SLPPGFRF+PTDVE MYYLKRKVMGKK Sbjct: 1 MVRTSLPPGFRFHPTDVELVMYYLKRKVMGKK 32 >XP_014660428.1 PREDICTED: NAC domain-containing protein 82-like [Setaria italica] XP_014660429.1 PREDICTED: NAC domain-containing protein 82-like [Setaria italica] Length = 453 Score = 59.7 bits (143), Expect = 3e-07 Identities = 26/32 (81%), Positives = 29/32 (90%) Frame = +1 Query: 439 MARMSLPPGFRFYPTDVEATMYYLKRKVMGKK 534 MA+ SLPPGFRF+PTDVE T YYLKRK+MGKK Sbjct: 1 MAQTSLPPGFRFHPTDVELTSYYLKRKIMGKK 32 >KXG22035.1 hypothetical protein SORBI_009G143700 [Sorghum bicolor] KXG22036.1 hypothetical protein SORBI_009G143700 [Sorghum bicolor] Length = 444 Score = 57.8 bits (138), Expect = 1e-06 Identities = 25/32 (78%), Positives = 28/32 (87%) Frame = +1 Query: 439 MARMSLPPGFRFYPTDVEATMYYLKRKVMGKK 534 MA+ SLPPGFRF+PTDVE YYLKRK+MGKK Sbjct: 1 MAQTSLPPGFRFHPTDVELVSYYLKRKIMGKK 32 >XP_008656268.1 PREDICTED: NAC domain-containing protein 55-like [Zea mays] AIB05468.1 NAC transcription factor, partial [Zea mays] AQK93661.1 Putative NAC domain transcription factor superfamily protein isoform 1 [Zea mays] AQK93662.1 Putative NAC domain transcription factor superfamily protein isoform 1 [Zea mays] AQK93663.1 Putative NAC domain transcription factor superfamily protein isoform 1 [Zea mays] AQK93664.1 Putative NAC domain transcription factor superfamily protein isoform 1 [Zea mays] AQK93665.1 Putative NAC domain transcription factor superfamily protein isoform 1 [Zea mays] Length = 445 Score = 57.8 bits (138), Expect = 1e-06 Identities = 25/32 (78%), Positives = 28/32 (87%) Frame = +1 Query: 439 MARMSLPPGFRFYPTDVEATMYYLKRKVMGKK 534 MA+ SLPPGFRF+PTDVE YYLKRK+MGKK Sbjct: 1 MAQTSLPPGFRFHPTDVELVSYYLKRKIMGKK 32 >OEL17627.1 NAC domain-containing protein 82 [Dichanthelium oligosanthes] Length = 450 Score = 57.8 bits (138), Expect = 1e-06 Identities = 25/32 (78%), Positives = 28/32 (87%) Frame = +1 Query: 439 MARMSLPPGFRFYPTDVEATMYYLKRKVMGKK 534 MA+ SLPPGFRF+PTDVE YYLKRK+MGKK Sbjct: 1 MAQTSLPPGFRFHPTDVELVSYYLKRKIMGKK 32 >XP_008649658.1 PREDICTED: uncharacterized protein LOC103630378 [Zea mays] AQK86084.1 Putative NAC domain transcription factor superfamily protein isoform 1 [Zea mays] AQK86085.1 Putative NAC domain transcription factor superfamily protein isoform 1 [Zea mays] Length = 452 Score = 57.8 bits (138), Expect = 1e-06 Identities = 25/32 (78%), Positives = 28/32 (87%) Frame = +1 Query: 439 MARMSLPPGFRFYPTDVEATMYYLKRKVMGKK 534 MA+ SLPPGFRF+PTDVE YYLKRK+MGKK Sbjct: 1 MAQTSLPPGFRFHPTDVEIVSYYLKRKIMGKK 32 >JAT54620.1 NAC domain-containing protein 78, partial [Anthurium amnicola] Length = 637 Score = 57.8 bits (138), Expect = 1e-06 Identities = 24/34 (70%), Positives = 30/34 (88%) Frame = +1 Query: 430 TFVMARMSLPPGFRFYPTDVEATMYYLKRKVMGK 531 + +MA+ SLPPGFRF+PTDVE + YYLKRK+MGK Sbjct: 58 SIIMAKPSLPPGFRFHPTDVELSCYYLKRKIMGK 91 >ONM15752.1 ras-related protein18A1, partial [Zea mays] Length = 299 Score = 57.0 bits (136), Expect = 2e-06 Identities = 24/31 (77%), Positives = 29/31 (93%) Frame = +1 Query: 439 MARMSLPPGFRFYPTDVEATMYYLKRKVMGK 531 MA+ SLPPGFRF+PTDVE T+YYLKRK++GK Sbjct: 1 MAKTSLPPGFRFHPTDVELTVYYLKRKLLGK 31 >ALC79002.1 NAC transcription factors 25 [Manihot esculenta] Length = 339 Score = 57.0 bits (136), Expect = 2e-06 Identities = 25/32 (78%), Positives = 27/32 (84%) Frame = +1 Query: 439 MARMSLPPGFRFYPTDVEATMYYLKRKVMGKK 534 M + SLPPGFRF+PTDVE YYLKRKVMGKK Sbjct: 1 MGKKSLPPGFRFHPTDVELVKYYLKRKVMGKK 32 >ONM15759.1 ras-related protein18A1 [Zea mays] Length = 370 Score = 57.0 bits (136), Expect = 2e-06 Identities = 24/31 (77%), Positives = 29/31 (93%) Frame = +1 Query: 439 MARMSLPPGFRFYPTDVEATMYYLKRKVMGK 531 MA+ SLPPGFRF+PTDVE T+YYLKRK++GK Sbjct: 1 MAKTSLPPGFRFHPTDVELTVYYLKRKLLGK 31 >ALC78988.1 NAC transcription factors 11 [Manihot esculenta] OAY36082.1 hypothetical protein MANES_12G154500 [Manihot esculenta] Length = 395 Score = 57.0 bits (136), Expect = 2e-06 Identities = 25/32 (78%), Positives = 27/32 (84%) Frame = +1 Query: 439 MARMSLPPGFRFYPTDVEATMYYLKRKVMGKK 534 M + SLPPGFRF+PTDVE YYLKRKVMGKK Sbjct: 1 MGKKSLPPGFRFHPTDVELVKYYLKRKVMGKK 32 >ALC78986.1 NAC transcription factors 9 [Manihot esculenta] OAY36083.1 hypothetical protein MANES_12G154500 [Manihot esculenta] Length = 396 Score = 57.0 bits (136), Expect = 2e-06 Identities = 25/32 (78%), Positives = 27/32 (84%) Frame = +1 Query: 439 MARMSLPPGFRFYPTDVEATMYYLKRKVMGKK 534 M + SLPPGFRF+PTDVE YYLKRKVMGKK Sbjct: 1 MGKKSLPPGFRFHPTDVELVKYYLKRKVMGKK 32