BLASTX nr result
ID: Angelica27_contig00030807
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00030807 (425 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017230567.1 PREDICTED: uncharacterized protein LOC108205218 [... 84 4e-16 OMO88538.1 hypothetical protein COLO4_20222 [Corchorus olitorius] 50 4e-06 >XP_017230567.1 PREDICTED: uncharacterized protein LOC108205218 [Daucus carota subsp. sativus] KZN12087.1 hypothetical protein DCAR_004743 [Daucus carota subsp. sativus] Length = 669 Score = 84.0 bits (206), Expect = 4e-16 Identities = 39/46 (84%), Positives = 42/46 (91%) Frame = +2 Query: 287 SEDNITSGLPECSTVDNPGSGCTQSDETSDIKFLVGLGKRIRDDDK 424 SED I++G PECSTVDNPGSGCTQSDETSDIKFLV LGKR RDD+K Sbjct: 93 SEDKISTGPPECSTVDNPGSGCTQSDETSDIKFLVELGKRTRDDEK 138 Score = 54.7 bits (130), Expect = 6e-06 Identities = 22/24 (91%), Positives = 23/24 (95%) Frame = +2 Query: 5 MSRCFPFPPPGYEKKARPDDENLL 76 MSRCFPFPPPGYE+K RPDDENLL Sbjct: 1 MSRCFPFPPPGYERKPRPDDENLL 24 >OMO88538.1 hypothetical protein COLO4_20222 [Corchorus olitorius] Length = 35 Score = 50.4 bits (119), Expect = 4e-06 Identities = 21/24 (87%), Positives = 22/24 (91%) Frame = +2 Query: 5 MSRCFPFPPPGYEKKARPDDENLL 76 MSRCFPFPPPGYEKKAR DD +LL Sbjct: 1 MSRCFPFPPPGYEKKARTDDADLL 24