BLASTX nr result
ID: Angelica27_contig00030569
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00030569 (386 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KZM82634.1 hypothetical protein DCAR_030203 [Daucus carota subsp... 89 1e-18 >KZM82634.1 hypothetical protein DCAR_030203 [Daucus carota subsp. sativus] Length = 288 Score = 88.6 bits (218), Expect = 1e-18 Identities = 50/100 (50%), Positives = 64/100 (64%), Gaps = 3/100 (3%) Frame = +1 Query: 94 VPSSFESVDVADTTPCSG---SVSLPRKRPSRTKLAKHNKIKNKVQELESARHINLLETL 264 +P++ ES + +TTP SG SVS PRKRPS KLAK NK K+KV+E+ +ARH++LLETL Sbjct: 146 IPNTCESPE-PETTPLSGGSGSVSSPRKRPSGKKLAKRNKAKSKVEEVHNARHMDLLETL 204 Query: 265 NKSVTENQVXXXXXXXXXXXXXXXXTICEEKKTTRKDTEM 384 NK++ +NQ T CEEKK RKD EM Sbjct: 205 NKNMVDNQARKMELEERMVVSLERQTSCEEKKIERKDLEM 244