BLASTX nr result
ID: Angelica27_contig00030485
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00030485 (300 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017216908.1 PREDICTED: AP2-like ethylene-responsive transcrip... 89 1e-18 >XP_017216908.1 PREDICTED: AP2-like ethylene-responsive transcription factor AIL7 [Daucus carota subsp. sativus] KZM86765.1 hypothetical protein DCAR_023899 [Daucus carota subsp. sativus] Length = 672 Score = 89.4 bits (220), Expect = 1e-18 Identities = 49/92 (53%), Positives = 56/92 (60%) Frame = +2 Query: 23 NDKTIGLSMIKNWLRNNSGPAENVNVSESNGDLVMASGNGXXXXXXXXXXXXXXXXXXXX 202 NDKTIGLSMIKNWLR+NS P++N+NVS+SNGDLVMASGNG Sbjct: 153 NDKTIGLSMIKNWLRSNSNPSDNINVSQSNGDLVMASGNG-TLTTGAQTLSLSMSTGSMA 211 Query: 203 XXXXXXXXXXXXXDNKRQIEASNCENGVVEAV 298 DNKRQ+E SN +NGVVEAV Sbjct: 212 GASSGGGGEILSSDNKRQMEGSNSQNGVVEAV 243