BLASTX nr result
ID: Angelica27_contig00030432
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00030432 (325 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017218261.1 PREDICTED: non-specific lipid-transfer protein-li... 65 1e-10 >XP_017218261.1 PREDICTED: non-specific lipid-transfer protein-like protein At2g13820 [Daucus carota subsp. sativus] KZM87039.1 hypothetical protein DCAR_024173 [Daucus carota subsp. sativus] Length = 216 Score = 65.5 bits (158), Expect = 1e-10 Identities = 35/60 (58%), Positives = 37/60 (61%) Frame = -3 Query: 323 AMTRGSSATPALTPPSDAAGAPTTNSGIRPVVNXXXXXXXXXXXXXXXXXXLGVAFLKYY 144 AMT S+ATP+LTPPSD AGAPTTNSGIRPVVN LG FLKYY Sbjct: 156 AMTPESNATPSLTPPSDTAGAPTTNSGIRPVVNPSAASPVFSFSPAFLLALLGATFLKYY 215