BLASTX nr result
ID: Angelica27_contig00030390
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00030390 (318 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KVH89945.1 SPOC domain protein [Cynara cardunculus var. scolymus] 56 8e-07 XP_010325147.1 PREDICTED: uncharacterized protein LOC101249111 i... 55 2e-06 XP_015085073.1 PREDICTED: uncharacterized protein LOC107028502 i... 55 2e-06 XP_016537965.1 PREDICTED: death-inducer obliterator 1 [Capsicum ... 55 2e-06 XP_006356613.1 PREDICTED: death-inducer obliterator 1-like [Sola... 55 2e-06 XP_016490453.1 PREDICTED: uncharacterized protein LOC107810211 [... 55 2e-06 XP_019252229.1 PREDICTED: death-inducer obliterator 1-like [Nico... 55 2e-06 XP_016498753.1 PREDICTED: death-inducer obliterator 1-like [Nico... 55 2e-06 XP_009590166.1 PREDICTED: death-inducer obliterator 1 [Nicotiana... 55 2e-06 XP_004245229.1 PREDICTED: uncharacterized protein LOC101249111 i... 55 2e-06 XP_009775581.1 PREDICTED: death-inducer obliterator 1-like [Nico... 55 2e-06 XP_015085072.1 PREDICTED: uncharacterized protein LOC107028502 i... 55 2e-06 KDO79633.1 hypothetical protein CISIN_1g001177mg [Citrus sinensis] 54 4e-06 EYU21912.1 hypothetical protein MIMGU_mgv1a000755mg [Erythranthe... 54 5e-06 XP_012855859.1 PREDICTED: uncharacterized protein LOC105975229 [... 54 5e-06 XP_019189914.1 PREDICTED: uncharacterized protein LOC109184378 [... 54 5e-06 OMO80520.1 hypothetical protein COLO4_24054 [Corchorus olitorius] 53 7e-06 EOY31364.1 SPOC domain / Transcription elongation factor S-II pr... 53 7e-06 XP_007013744.2 PREDICTED: death-inducer obliterator 1 [Theobroma... 53 7e-06 EOY31363.1 SPOC domain / Transcription elongation factor S-II pr... 53 7e-06 >KVH89945.1 SPOC domain protein [Cynara cardunculus var. scolymus] Length = 1160 Score = 55.8 bits (133), Expect = 8e-07 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = -2 Query: 317 KGRVRLDAFEKFLQELPMSRSRAVMVY 237 KGRVRLDAFEKFLQELPMSRSRAVMVY Sbjct: 714 KGRVRLDAFEKFLQELPMSRSRAVMVY 740 >XP_010325147.1 PREDICTED: uncharacterized protein LOC101249111 isoform X2 [Solanum lycopersicum] Length = 1035 Score = 54.7 bits (130), Expect = 2e-06 Identities = 27/28 (96%), Positives = 27/28 (96%) Frame = -2 Query: 317 KGRVRLDAFEKFLQELPMSRSRAVMVYQ 234 KGRVRLDAFEKFLQELPMSRSRAVMV Q Sbjct: 719 KGRVRLDAFEKFLQELPMSRSRAVMVVQ 746 >XP_015085073.1 PREDICTED: uncharacterized protein LOC107028502 isoform X2 [Solanum pennellii] Length = 1038 Score = 54.7 bits (130), Expect = 2e-06 Identities = 27/28 (96%), Positives = 27/28 (96%) Frame = -2 Query: 317 KGRVRLDAFEKFLQELPMSRSRAVMVYQ 234 KGRVRLDAFEKFLQELPMSRSRAVMV Q Sbjct: 719 KGRVRLDAFEKFLQELPMSRSRAVMVVQ 746 >XP_016537965.1 PREDICTED: death-inducer obliterator 1 [Capsicum annuum] XP_016537966.1 PREDICTED: death-inducer obliterator 1 [Capsicum annuum] Length = 1056 Score = 54.7 bits (130), Expect = 2e-06 Identities = 27/28 (96%), Positives = 27/28 (96%) Frame = -2 Query: 317 KGRVRLDAFEKFLQELPMSRSRAVMVYQ 234 KGRVRLDAFEKFLQELPMSRSRAVMV Q Sbjct: 725 KGRVRLDAFEKFLQELPMSRSRAVMVVQ 752 >XP_006356613.1 PREDICTED: death-inducer obliterator 1-like [Solanum tuberosum] XP_015168486.1 PREDICTED: death-inducer obliterator 1-like [Solanum tuberosum] Length = 1056 Score = 54.7 bits (130), Expect = 2e-06 Identities = 27/28 (96%), Positives = 27/28 (96%) Frame = -2 Query: 317 KGRVRLDAFEKFLQELPMSRSRAVMVYQ 234 KGRVRLDAFEKFLQELPMSRSRAVMV Q Sbjct: 722 KGRVRLDAFEKFLQELPMSRSRAVMVVQ 749 >XP_016490453.1 PREDICTED: uncharacterized protein LOC107810211 [Nicotiana tabacum] XP_016490454.1 PREDICTED: uncharacterized protein LOC107810211 [Nicotiana tabacum] Length = 1064 Score = 54.7 bits (130), Expect = 2e-06 Identities = 27/28 (96%), Positives = 27/28 (96%) Frame = -2 Query: 317 KGRVRLDAFEKFLQELPMSRSRAVMVYQ 234 KGRVRLDAFEKFLQELPMSRSRAVMV Q Sbjct: 734 KGRVRLDAFEKFLQELPMSRSRAVMVVQ 761 >XP_019252229.1 PREDICTED: death-inducer obliterator 1-like [Nicotiana attenuata] OIS99498.1 transcription elongation factor tfiis [Nicotiana attenuata] Length = 1065 Score = 54.7 bits (130), Expect = 2e-06 Identities = 27/28 (96%), Positives = 27/28 (96%) Frame = -2 Query: 317 KGRVRLDAFEKFLQELPMSRSRAVMVYQ 234 KGRVRLDAFEKFLQELPMSRSRAVMV Q Sbjct: 734 KGRVRLDAFEKFLQELPMSRSRAVMVVQ 761 >XP_016498753.1 PREDICTED: death-inducer obliterator 1-like [Nicotiana tabacum] Length = 1065 Score = 54.7 bits (130), Expect = 2e-06 Identities = 27/28 (96%), Positives = 27/28 (96%) Frame = -2 Query: 317 KGRVRLDAFEKFLQELPMSRSRAVMVYQ 234 KGRVRLDAFEKFLQELPMSRSRAVMV Q Sbjct: 734 KGRVRLDAFEKFLQELPMSRSRAVMVVQ 761 >XP_009590166.1 PREDICTED: death-inducer obliterator 1 [Nicotiana tomentosiformis] XP_018623322.1 PREDICTED: death-inducer obliterator 1 [Nicotiana tomentosiformis] Length = 1065 Score = 54.7 bits (130), Expect = 2e-06 Identities = 27/28 (96%), Positives = 27/28 (96%) Frame = -2 Query: 317 KGRVRLDAFEKFLQELPMSRSRAVMVYQ 234 KGRVRLDAFEKFLQELPMSRSRAVMV Q Sbjct: 734 KGRVRLDAFEKFLQELPMSRSRAVMVVQ 761 >XP_004245229.1 PREDICTED: uncharacterized protein LOC101249111 isoform X1 [Solanum lycopersicum] Length = 1066 Score = 54.7 bits (130), Expect = 2e-06 Identities = 27/28 (96%), Positives = 27/28 (96%) Frame = -2 Query: 317 KGRVRLDAFEKFLQELPMSRSRAVMVYQ 234 KGRVRLDAFEKFLQELPMSRSRAVMV Q Sbjct: 750 KGRVRLDAFEKFLQELPMSRSRAVMVVQ 777 >XP_009775581.1 PREDICTED: death-inducer obliterator 1-like [Nicotiana sylvestris] XP_009775582.1 PREDICTED: death-inducer obliterator 1-like [Nicotiana sylvestris] Length = 1067 Score = 54.7 bits (130), Expect = 2e-06 Identities = 27/28 (96%), Positives = 27/28 (96%) Frame = -2 Query: 317 KGRVRLDAFEKFLQELPMSRSRAVMVYQ 234 KGRVRLDAFEKFLQELPMSRSRAVMV Q Sbjct: 734 KGRVRLDAFEKFLQELPMSRSRAVMVVQ 761 >XP_015085072.1 PREDICTED: uncharacterized protein LOC107028502 isoform X1 [Solanum pennellii] Length = 1069 Score = 54.7 bits (130), Expect = 2e-06 Identities = 27/28 (96%), Positives = 27/28 (96%) Frame = -2 Query: 317 KGRVRLDAFEKFLQELPMSRSRAVMVYQ 234 KGRVRLDAFEKFLQELPMSRSRAVMV Q Sbjct: 750 KGRVRLDAFEKFLQELPMSRSRAVMVVQ 777 >KDO79633.1 hypothetical protein CISIN_1g001177mg [Citrus sinensis] Length = 853 Score = 53.9 bits (128), Expect = 4e-06 Identities = 25/36 (69%), Positives = 31/36 (86%) Frame = -2 Query: 317 KGRVRLDAFEKFLQELPMSRSRAVMVYQVSFYVLSH 210 KGRV+LDAFEK+LQ+LPMSRSRAVMV QV + + + Sbjct: 769 KGRVKLDAFEKYLQQLPMSRSRAVMVSQVCLHCIKY 804 >EYU21912.1 hypothetical protein MIMGU_mgv1a000755mg [Erythranthe guttata] Length = 993 Score = 53.5 bits (127), Expect = 5e-06 Identities = 26/28 (92%), Positives = 27/28 (96%) Frame = -2 Query: 317 KGRVRLDAFEKFLQELPMSRSRAVMVYQ 234 KGRVRLDAFEKFLQELPMSR+RAVMV Q Sbjct: 665 KGRVRLDAFEKFLQELPMSRTRAVMVLQ 692 >XP_012855859.1 PREDICTED: uncharacterized protein LOC105975229 [Erythranthe guttata] Length = 1029 Score = 53.5 bits (127), Expect = 5e-06 Identities = 26/28 (92%), Positives = 27/28 (96%) Frame = -2 Query: 317 KGRVRLDAFEKFLQELPMSRSRAVMVYQ 234 KGRVRLDAFEKFLQELPMSR+RAVMV Q Sbjct: 701 KGRVRLDAFEKFLQELPMSRTRAVMVLQ 728 >XP_019189914.1 PREDICTED: uncharacterized protein LOC109184378 [Ipomoea nil] XP_019189915.1 PREDICTED: uncharacterized protein LOC109184378 [Ipomoea nil] XP_019189916.1 PREDICTED: uncharacterized protein LOC109184378 [Ipomoea nil] XP_019189917.1 PREDICTED: uncharacterized protein LOC109184378 [Ipomoea nil] Length = 1112 Score = 53.5 bits (127), Expect = 5e-06 Identities = 26/28 (92%), Positives = 27/28 (96%) Frame = -2 Query: 317 KGRVRLDAFEKFLQELPMSRSRAVMVYQ 234 KGRVR+DAFEKFLQELPMSRSRAVMV Q Sbjct: 741 KGRVRIDAFEKFLQELPMSRSRAVMVTQ 768 >OMO80520.1 hypothetical protein COLO4_24054 [Corchorus olitorius] Length = 1054 Score = 53.1 bits (126), Expect = 7e-06 Identities = 26/26 (100%), Positives = 26/26 (100%) Frame = -2 Query: 317 KGRVRLDAFEKFLQELPMSRSRAVMV 240 KGRVRLDAFEKFLQELPMSRSRAVMV Sbjct: 687 KGRVRLDAFEKFLQELPMSRSRAVMV 712 >EOY31364.1 SPOC domain / Transcription elongation factor S-II protein, putative isoform 2 [Theobroma cacao] Length = 1054 Score = 53.1 bits (126), Expect = 7e-06 Identities = 26/26 (100%), Positives = 26/26 (100%) Frame = -2 Query: 317 KGRVRLDAFEKFLQELPMSRSRAVMV 240 KGRVRLDAFEKFLQELPMSRSRAVMV Sbjct: 698 KGRVRLDAFEKFLQELPMSRSRAVMV 723 >XP_007013744.2 PREDICTED: death-inducer obliterator 1 [Theobroma cacao] Length = 1061 Score = 53.1 bits (126), Expect = 7e-06 Identities = 26/26 (100%), Positives = 26/26 (100%) Frame = -2 Query: 317 KGRVRLDAFEKFLQELPMSRSRAVMV 240 KGRVRLDAFEKFLQELPMSRSRAVMV Sbjct: 705 KGRVRLDAFEKFLQELPMSRSRAVMV 730 >EOY31363.1 SPOC domain / Transcription elongation factor S-II protein, putative isoform 1 [Theobroma cacao] Length = 1061 Score = 53.1 bits (126), Expect = 7e-06 Identities = 26/26 (100%), Positives = 26/26 (100%) Frame = -2 Query: 317 KGRVRLDAFEKFLQELPMSRSRAVMV 240 KGRVRLDAFEKFLQELPMSRSRAVMV Sbjct: 705 KGRVRLDAFEKFLQELPMSRSRAVMV 730