BLASTX nr result
ID: Angelica27_contig00030340
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00030340 (346 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017224053.1 PREDICTED: putative pentatricopeptide repeat-cont... 87 2e-17 XP_017224051.1 PREDICTED: putative pentatricopeptide repeat-cont... 87 2e-17 XP_017227665.1 PREDICTED: putative pentatricopeptide repeat-cont... 87 2e-17 BAT79053.1 hypothetical protein VIGAN_02185500 [Vigna angularis ... 70 1e-12 XP_004503024.1 PREDICTED: putative pentatricopeptide repeat-cont... 73 1e-12 XP_019433904.1 PREDICTED: putative pentatricopeptide repeat-cont... 72 2e-12 KHG08954.1 Putative pentatricopeptide repeat-containing -like pr... 70 4e-12 XP_010521571.1 PREDICTED: putative pentatricopeptide repeat-cont... 71 6e-12 KOM40703.1 hypothetical protein LR48_Vigan04g090100 [Vigna angul... 70 6e-12 XP_003602712.2 PPR containing plant-like protein [Medicago trunc... 70 1e-11 KYP69505.1 Putative pentatricopeptide repeat-containing protein ... 70 1e-11 KJB71403.1 hypothetical protein B456_011G121300 [Gossypium raimo... 70 1e-11 XP_014506169.1 PREDICTED: putative pentatricopeptide repeat-cont... 70 1e-11 XP_017420267.1 PREDICTED: putative pentatricopeptide repeat-cont... 70 1e-11 XP_007137835.1 hypothetical protein PHAVU_009G159700g [Phaseolus... 70 1e-11 XP_017606028.1 PREDICTED: putative pentatricopeptide repeat-cont... 70 1e-11 XP_016698819.1 PREDICTED: putative pentatricopeptide repeat-cont... 70 1e-11 XP_016677654.1 PREDICTED: putative pentatricopeptide repeat-cont... 70 1e-11 XP_012453736.1 PREDICTED: putative pentatricopeptide repeat-cont... 70 1e-11 XP_015937620.1 PREDICTED: putative pentatricopeptide repeat-cont... 69 2e-11 >XP_017224053.1 PREDICTED: putative pentatricopeptide repeat-containing protein At5g08490 isoform X3 [Daucus carota subsp. sativus] XP_017224054.1 PREDICTED: putative pentatricopeptide repeat-containing protein At5g08490 isoform X3 [Daucus carota subsp. sativus] Length = 744 Score = 86.7 bits (213), Expect = 2e-17 Identities = 41/47 (87%), Positives = 43/47 (91%) Frame = +3 Query: 3 KKSAGSSWIEVEGRNNVFIAGDCSHPCRNSIYSTLFNLDTQIREQFK 143 KKSAGSSWIEVEGRNNVFIAGD SHP RN+IYSTL NLDT IRE+FK Sbjct: 697 KKSAGSSWIEVEGRNNVFIAGDTSHPYRNNIYSTLLNLDTHIRERFK 743 >XP_017224051.1 PREDICTED: putative pentatricopeptide repeat-containing protein At5g08490 isoform X1 [Daucus carota subsp. sativus] Length = 852 Score = 86.7 bits (213), Expect = 2e-17 Identities = 41/47 (87%), Positives = 43/47 (91%) Frame = +3 Query: 3 KKSAGSSWIEVEGRNNVFIAGDCSHPCRNSIYSTLFNLDTQIREQFK 143 KKSAGSSWIEVEGRNNVFIAGD SHP RN+IYSTL NLDT IRE+FK Sbjct: 805 KKSAGSSWIEVEGRNNVFIAGDTSHPYRNNIYSTLLNLDTHIRERFK 851 >XP_017227665.1 PREDICTED: putative pentatricopeptide repeat-containing protein At5g08490 isoform X2 [Daucus carota subsp. sativus] Length = 852 Score = 86.7 bits (213), Expect = 2e-17 Identities = 41/47 (87%), Positives = 43/47 (91%) Frame = +3 Query: 3 KKSAGSSWIEVEGRNNVFIAGDCSHPCRNSIYSTLFNLDTQIREQFK 143 KKSAGSSWIEVEGRNNVFIAGD SHP RN+IYSTL NLDT IRE+FK Sbjct: 805 KKSAGSSWIEVEGRNNVFIAGDTSHPYRNNIYSTLLNLDTHIRERFK 851 >BAT79053.1 hypothetical protein VIGAN_02185500 [Vigna angularis var. angularis] Length = 152 Score = 69.7 bits (169), Expect = 1e-12 Identities = 31/48 (64%), Positives = 37/48 (77%) Frame = +3 Query: 3 KKSAGSSWIEVEGRNNVFIAGDCSHPCRNSIYSTLFNLDTQIREQFKF 146 KK AG SWIEVE NN+F+AGDCSHP R+ IYSTL LD Q++E +F Sbjct: 103 KKPAGCSWIEVERSNNIFVAGDCSHPQRSIIYSTLHTLDQQVKEPVEF 150 >XP_004503024.1 PREDICTED: putative pentatricopeptide repeat-containing protein At5g08490 [Cicer arietinum] Length = 874 Score = 72.8 bits (177), Expect = 1e-12 Identities = 31/48 (64%), Positives = 39/48 (81%) Frame = +3 Query: 3 KKSAGSSWIEVEGRNNVFIAGDCSHPCRNSIYSTLFNLDTQIREQFKF 146 KK AG SWIEVE +NN+F+AGDCSHP R+ IYSTL+ LD Q++E +F Sbjct: 827 KKPAGCSWIEVERKNNIFVAGDCSHPQRSLIYSTLYTLDQQVKEPMEF 874 >XP_019433904.1 PREDICTED: putative pentatricopeptide repeat-containing protein At5g08490 [Lupinus angustifolius] OIW21819.1 hypothetical protein TanjilG_11554 [Lupinus angustifolius] Length = 873 Score = 72.0 bits (175), Expect = 2e-12 Identities = 32/48 (66%), Positives = 38/48 (79%) Frame = +3 Query: 3 KKSAGSSWIEVEGRNNVFIAGDCSHPCRNSIYSTLFNLDTQIREQFKF 146 KK AG SWIEVE NN+F+AGDCSHP R+ IYSTL+ LD QI+E +F Sbjct: 826 KKPAGCSWIEVERMNNIFVAGDCSHPQRSIIYSTLYTLDQQIKETLEF 873 >KHG08954.1 Putative pentatricopeptide repeat-containing -like protein [Gossypium arboreum] Length = 225 Score = 69.7 bits (169), Expect = 4e-12 Identities = 33/48 (68%), Positives = 37/48 (77%) Frame = +3 Query: 3 KKSAGSSWIEVEGRNNVFIAGDCSHPCRNSIYSTLFNLDTQIREQFKF 146 KKSAG SWIEVE RN+VFIAGDC HP R IYST+ LD Q++E F F Sbjct: 168 KKSAGCSWIEVEKRNSVFIAGDCFHPKREIIYSTISTLDQQMKETFLF 215 >XP_010521571.1 PREDICTED: putative pentatricopeptide repeat-containing protein At5g08490 [Tarenaya hassleriana] Length = 852 Score = 70.9 bits (172), Expect = 6e-12 Identities = 31/47 (65%), Positives = 37/47 (78%) Frame = +3 Query: 3 KKSAGSSWIEVEGRNNVFIAGDCSHPCRNSIYSTLFNLDTQIREQFK 143 KK AG SWIEVEG+ NVF+AGDCSHP RNSI+STL L Q++E + Sbjct: 804 KKPAGCSWIEVEGKRNVFVAGDCSHPQRNSIFSTLLTLGRQVKESLQ 850 >KOM40703.1 hypothetical protein LR48_Vigan04g090100 [Vigna angularis] Length = 260 Score = 69.7 bits (169), Expect = 6e-12 Identities = 31/48 (64%), Positives = 37/48 (77%) Frame = +3 Query: 3 KKSAGSSWIEVEGRNNVFIAGDCSHPCRNSIYSTLFNLDTQIREQFKF 146 KK AG SWIEVE NN+F+AGDCSHP R+ IYSTL LD Q++E +F Sbjct: 211 KKPAGCSWIEVERSNNIFVAGDCSHPQRSIIYSTLHTLDQQVKEPVEF 258 >XP_003602712.2 PPR containing plant-like protein [Medicago truncatula] AES72963.2 PPR containing plant-like protein [Medicago truncatula] Length = 873 Score = 70.1 bits (170), Expect = 1e-11 Identities = 31/48 (64%), Positives = 36/48 (75%) Frame = +3 Query: 3 KKSAGSSWIEVEGRNNVFIAGDCSHPCRNSIYSTLFNLDTQIREQFKF 146 KK AG SWIEVE NN+F+ GDCSHP RN IYSTL LD Q++E +F Sbjct: 826 KKPAGCSWIEVERTNNIFVVGDCSHPQRNLIYSTLCTLDQQVKEPMEF 873 >KYP69505.1 Putative pentatricopeptide repeat-containing protein At5g08490 family [Cajanus cajan] Length = 605 Score = 69.7 bits (169), Expect = 1e-11 Identities = 31/48 (64%), Positives = 37/48 (77%) Frame = +3 Query: 3 KKSAGSSWIEVEGRNNVFIAGDCSHPCRNSIYSTLFNLDTQIREQFKF 146 KK AG SWIEVE NN+F+AGDCSHP R+ IYSTL LD Q++E +F Sbjct: 556 KKPAGCSWIEVERTNNIFVAGDCSHPQRSIIYSTLHTLDQQVKEPVEF 603 >KJB71403.1 hypothetical protein B456_011G121300 [Gossypium raimondii] KJB71404.1 hypothetical protein B456_011G121300 [Gossypium raimondii] Length = 796 Score = 69.7 bits (169), Expect = 1e-11 Identities = 33/48 (68%), Positives = 37/48 (77%) Frame = +3 Query: 3 KKSAGSSWIEVEGRNNVFIAGDCSHPCRNSIYSTLFNLDTQIREQFKF 146 KKSAG SWIEVE RN+VFIAGDC HP R IYST+ LD Q++E F F Sbjct: 739 KKSAGCSWIEVEKRNSVFIAGDCFHPKREIIYSTISTLDQQMKEPFLF 786 >XP_014506169.1 PREDICTED: putative pentatricopeptide repeat-containing protein At5g08490 [Vigna radiata var. radiata] Length = 875 Score = 69.7 bits (169), Expect = 1e-11 Identities = 31/48 (64%), Positives = 37/48 (77%) Frame = +3 Query: 3 KKSAGSSWIEVEGRNNVFIAGDCSHPCRNSIYSTLFNLDTQIREQFKF 146 KK AG SWIEVE NN+F+AGDCSHP R+ IYSTL LD Q++E +F Sbjct: 826 KKPAGCSWIEVERSNNIFVAGDCSHPQRSIIYSTLHTLDQQVKEPVEF 873 >XP_017420267.1 PREDICTED: putative pentatricopeptide repeat-containing protein At5g08490 [Vigna angularis] KOM40701.1 hypothetical protein LR48_Vigan04g089900 [Vigna angularis] Length = 875 Score = 69.7 bits (169), Expect = 1e-11 Identities = 31/48 (64%), Positives = 37/48 (77%) Frame = +3 Query: 3 KKSAGSSWIEVEGRNNVFIAGDCSHPCRNSIYSTLFNLDTQIREQFKF 146 KK AG SWIEVE NN+F+AGDCSHP R+ IYSTL LD Q++E +F Sbjct: 826 KKPAGCSWIEVERSNNIFVAGDCSHPQRSIIYSTLHTLDQQVKEPVEF 873 >XP_007137835.1 hypothetical protein PHAVU_009G159700g [Phaseolus vulgaris] ESW09829.1 hypothetical protein PHAVU_009G159700g [Phaseolus vulgaris] Length = 875 Score = 69.7 bits (169), Expect = 1e-11 Identities = 31/48 (64%), Positives = 37/48 (77%) Frame = +3 Query: 3 KKSAGSSWIEVEGRNNVFIAGDCSHPCRNSIYSTLFNLDTQIREQFKF 146 KK AG SWIEVE NN+F+AGDCSHP R+ IYSTL LD Q++E +F Sbjct: 826 KKPAGCSWIEVERSNNIFVAGDCSHPQRSIIYSTLHTLDQQVKEPVEF 873 >XP_017606028.1 PREDICTED: putative pentatricopeptide repeat-containing protein At5g08490 [Gossypium arboreum] Length = 883 Score = 69.7 bits (169), Expect = 1e-11 Identities = 33/48 (68%), Positives = 37/48 (77%) Frame = +3 Query: 3 KKSAGSSWIEVEGRNNVFIAGDCSHPCRNSIYSTLFNLDTQIREQFKF 146 KKSAG SWIEVE RN+VFIAGDC HP R IYST+ LD Q++E F F Sbjct: 826 KKSAGCSWIEVEKRNSVFIAGDCFHPKREIIYSTISTLDQQMKETFLF 873 >XP_016698819.1 PREDICTED: putative pentatricopeptide repeat-containing protein At5g08490 [Gossypium hirsutum] Length = 883 Score = 69.7 bits (169), Expect = 1e-11 Identities = 33/48 (68%), Positives = 37/48 (77%) Frame = +3 Query: 3 KKSAGSSWIEVEGRNNVFIAGDCSHPCRNSIYSTLFNLDTQIREQFKF 146 KKSAG SWIEVE RN+VFIAGDC HP R IYST+ LD Q++E F F Sbjct: 826 KKSAGCSWIEVEKRNSVFIAGDCFHPKREIIYSTISTLDQQMKEPFLF 873 >XP_016677654.1 PREDICTED: putative pentatricopeptide repeat-containing protein At5g08490 isoform X1 [Gossypium hirsutum] XP_016677655.1 PREDICTED: putative pentatricopeptide repeat-containing protein At5g08490 isoform X1 [Gossypium hirsutum] Length = 883 Score = 69.7 bits (169), Expect = 1e-11 Identities = 33/48 (68%), Positives = 37/48 (77%) Frame = +3 Query: 3 KKSAGSSWIEVEGRNNVFIAGDCSHPCRNSIYSTLFNLDTQIREQFKF 146 KKSAG SWIEVE RN+VFIAGDC HP R IYST+ LD Q++E F F Sbjct: 826 KKSAGCSWIEVEKRNSVFIAGDCFHPKREIIYSTISTLDQQMKETFLF 873 >XP_012453736.1 PREDICTED: putative pentatricopeptide repeat-containing protein At5g08490 [Gossypium raimondii] XP_012453737.1 PREDICTED: putative pentatricopeptide repeat-containing protein At5g08490 [Gossypium raimondii] XP_012453738.1 PREDICTED: putative pentatricopeptide repeat-containing protein At5g08490 [Gossypium raimondii] Length = 883 Score = 69.7 bits (169), Expect = 1e-11 Identities = 33/48 (68%), Positives = 37/48 (77%) Frame = +3 Query: 3 KKSAGSSWIEVEGRNNVFIAGDCSHPCRNSIYSTLFNLDTQIREQFKF 146 KKSAG SWIEVE RN+VFIAGDC HP R IYST+ LD Q++E F F Sbjct: 826 KKSAGCSWIEVEKRNSVFIAGDCFHPKREIIYSTISTLDQQMKEPFLF 873 >XP_015937620.1 PREDICTED: putative pentatricopeptide repeat-containing protein At5g08490 [Arachis duranensis] Length = 875 Score = 69.3 bits (168), Expect = 2e-11 Identities = 31/48 (64%), Positives = 38/48 (79%) Frame = +3 Query: 3 KKSAGSSWIEVEGRNNVFIAGDCSHPCRNSIYSTLFNLDTQIREQFKF 146 KK AG SWIEVE ++N+F+AGDCSHP R+ IYSTL LD QI+E +F Sbjct: 826 KKPAGCSWIEVEKKHNIFVAGDCSHPQRSIIYSTLCTLDQQIKEPIEF 873