BLASTX nr result
ID: Angelica27_contig00030312
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00030312 (456 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017242243.1 PREDICTED: mechanosensitive ion channel protein 6... 70 4e-11 XP_017241265.1 PREDICTED: mechanosensitive ion channel protein 6... 62 2e-08 XP_017237419.1 PREDICTED: mechanosensitive ion channel protein 6... 57 2e-06 >XP_017242243.1 PREDICTED: mechanosensitive ion channel protein 6-like [Daucus carota subsp. sativus] KZN00764.1 hypothetical protein DCAR_009518 [Daucus carota subsp. sativus] Length = 787 Score = 70.1 bits (170), Expect = 4e-11 Identities = 33/50 (66%), Positives = 36/50 (72%) Frame = +2 Query: 305 FSDFKCPGWKGRNRVKSGCLEEESECHDDDPYVEEDFSEEFKMTKFSKWA 454 F DF+ R+ GC+EEESE HDDDPYVEEDF EEFKM KFSKWA Sbjct: 128 FEDFR------RSMKSGGCIEEESEYHDDDPYVEEDFPEEFKMIKFSKWA 171 >XP_017241265.1 PREDICTED: mechanosensitive ion channel protein 6-like [Daucus carota subsp. sativus] KZN00763.1 hypothetical protein DCAR_009517 [Daucus carota subsp. sativus] Length = 782 Score = 62.0 bits (149), Expect = 2e-08 Identities = 26/32 (81%), Positives = 28/32 (87%) Frame = +2 Query: 359 CLEEESECHDDDPYVEEDFSEEFKMTKFSKWA 454 C+EE S+ HDDDPYVEEDF EEFKM KFSKWA Sbjct: 138 CIEEGSDVHDDDPYVEEDFPEEFKMIKFSKWA 169 >XP_017237419.1 PREDICTED: mechanosensitive ion channel protein 6-like [Daucus carota subsp. sativus] KZN00762.1 hypothetical protein DCAR_009516 [Daucus carota subsp. sativus] Length = 768 Score = 56.6 bits (135), Expect = 2e-06 Identities = 24/36 (66%), Positives = 27/36 (75%) Frame = +2 Query: 347 VKSGCLEEESECHDDDPYVEEDFSEEFKMTKFSKWA 454 +KS C+E SEC DDPY +ED EEFKM KFSKWA Sbjct: 122 MKSECMEARSECQYDDPYAKEDLPEEFKMIKFSKWA 157