BLASTX nr result
ID: Angelica27_contig00030276
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00030276 (538 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_003605622.1 hypothetical protein MTR_4g035030 [Medicago trunc... 78 1e-15 XP_003615432.1 hypothetical protein MTR_5g067940 [Medicago trunc... 76 3e-15 KJB23821.1 hypothetical protein B456_004G116300 [Gossypium raimo... 56 8e-08 >XP_003605622.1 hypothetical protein MTR_4g035030 [Medicago truncatula] AES87819.1 hypothetical protein MTR_4g035030 [Medicago truncatula] Length = 95 Score = 77.8 bits (190), Expect = 1e-15 Identities = 46/69 (66%), Positives = 51/69 (73%), Gaps = 6/69 (8%) Frame = -1 Query: 538 AKLVDAADLIGLSLGMETY*VRTFKFRETPELIKMGNPEPNPIFQKQ------TKAQKVK 377 AKLVDA DLIGLSLGMETY V+TFKFRET EL KMGNPEPNP F+KQ ++ QK Sbjct: 2 AKLVDATDLIGLSLGMETYQVKTFKFRETLEL-KMGNPEPNPSFRKQINKSLESENQKRI 60 Query: 376 KG*VQRLNG 350 G V R+ G Sbjct: 61 GGGVSRMVG 69 >XP_003615432.1 hypothetical protein MTR_5g067940 [Medicago truncatula] AES98390.1 hypothetical protein MTR_5g067940 [Medicago truncatula] Length = 69 Score = 75.9 bits (185), Expect = 3e-15 Identities = 39/47 (82%), Positives = 42/47 (89%) Frame = -1 Query: 538 AKLVDAADLIGLSLGMETY*VRTFKFRETPELIKMGNPEPNPIFQKQ 398 A+LVDA DLIGLSLGMETY V+TFKFRET EL KMGNPEPNP F+KQ Sbjct: 2 AELVDATDLIGLSLGMETYQVKTFKFRETLEL-KMGNPEPNPSFRKQ 47 >KJB23821.1 hypothetical protein B456_004G116300 [Gossypium raimondii] Length = 34 Score = 55.8 bits (133), Expect = 8e-08 Identities = 28/36 (77%), Positives = 30/36 (83%) Frame = -3 Query: 533 IGRRCGLNWIEPWYGNLLSENFQIQRNPGINKNGQS 426 IGR LNWIE WYGNL S+NFQIQRNPG+ KNGQS Sbjct: 3 IGR---LNWIESWYGNLRSDNFQIQRNPGM-KNGQS 34