BLASTX nr result
ID: Angelica27_contig00030261
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00030261 (329 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value OAP18148.1 hypothetical protein AXX17_AT1G34110 [Arabidopsis tha... 50 6e-06 >OAP18148.1 hypothetical protein AXX17_AT1G34110 [Arabidopsis thaliana] Length = 71 Score = 50.1 bits (118), Expect = 6e-06 Identities = 21/33 (63%), Positives = 25/33 (75%) Frame = +2 Query: 200 KAKVGNICATSFDWSCRGI*KSLDTIAEVQRWC 298 KA+ GN+CA SFDWSC GI KS+D +A V R C Sbjct: 25 KAQAGNVCAASFDWSCSGICKSVDRMARVHRAC 57