BLASTX nr result
ID: Angelica27_contig00030225
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00030225 (654 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KZM90464.1 hypothetical protein DCAR_022171 [Daucus carota subsp... 65 1e-08 XP_017256470.1 PREDICTED: uncharacterized protein LOC108226027 [... 65 1e-08 >KZM90464.1 hypothetical protein DCAR_022171 [Daucus carota subsp. sativus] Length = 834 Score = 64.7 bits (156), Expect = 1e-08 Identities = 31/41 (75%), Positives = 33/41 (80%) Frame = -3 Query: 193 SYNRDASGIVTSGGLQNFVGGAEKKHKDINCISKDASNAVK 71 SYNRDASG TSG LQN G EKKHKDI CISKDAS+A+K Sbjct: 190 SYNRDASGTFTSGALQNSAVGTEKKHKDIYCISKDASDAIK 230 >XP_017256470.1 PREDICTED: uncharacterized protein LOC108226027 [Daucus carota subsp. sativus] Length = 889 Score = 64.7 bits (156), Expect = 1e-08 Identities = 31/41 (75%), Positives = 33/41 (80%) Frame = -3 Query: 193 SYNRDASGIVTSGGLQNFVGGAEKKHKDINCISKDASNAVK 71 SYNRDASG TSG LQN G EKKHKDI CISKDAS+A+K Sbjct: 245 SYNRDASGTFTSGALQNSAVGTEKKHKDIYCISKDASDAIK 285