BLASTX nr result
ID: Angelica27_contig00030180
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00030180 (216 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017256859.1 PREDICTED: feruloyl CoA ortho-hydroxylase 1-like ... 84 1e-17 KZM90827.1 hypothetical protein DCAR_021808 [Daucus carota subsp... 81 1e-16 XP_019248988.1 PREDICTED: feruloyl CoA ortho-hydroxylase 1-like ... 81 2e-16 XP_009588065.1 PREDICTED: feruloyl CoA ortho-hydroxylase 1-like ... 80 3e-16 XP_016504123.1 PREDICTED: feruloyl CoA ortho-hydroxylase 1-like ... 77 4e-16 KZM84736.1 hypothetical protein DCAR_027842 [Daucus carota subsp... 75 7e-16 XP_009758809.1 PREDICTED: feruloyl CoA ortho-hydroxylase 1-like ... 79 1e-15 XP_017223189.1 PREDICTED: feruloyl CoA ortho-hydroxylase 2-like ... 77 7e-15 CDP19904.1 unnamed protein product [Coffea canephora] 76 1e-14 XP_006368541.1 hypothetical protein POPTR_0001s04390g [Populus t... 75 2e-14 XP_019155677.1 PREDICTED: feruloyl CoA ortho-hydroxylase 1-like ... 75 2e-14 XP_016474847.1 PREDICTED: feruloyl CoA ortho-hydroxylase 1-like ... 75 2e-14 XP_009763424.1 PREDICTED: feruloyl CoA ortho-hydroxylase 2-like ... 75 2e-14 XP_019257579.1 PREDICTED: feruloyl CoA ortho-hydroxylase 2-like ... 75 2e-14 BAL22345.1 oxidoreductase [Ipomoea batatas] 75 2e-14 BAL22344.1 oxidoreductase [Ipomoea batatas] 75 2e-14 BAL22343.1 oxidoreductase [Ipomoea batatas] 75 2e-14 XP_002299115.2 oxidoreductase family protein [Populus trichocarp... 75 3e-14 XP_011048230.1 PREDICTED: feruloyl CoA ortho-hydroxylase 1-like ... 75 4e-14 XP_008218314.1 PREDICTED: feruloyl CoA ortho-hydroxylase 1-like ... 75 4e-14 >XP_017256859.1 PREDICTED: feruloyl CoA ortho-hydroxylase 1-like [Daucus carota subsp. sativus] KZM90829.1 hypothetical protein DCAR_021806 [Daucus carota subsp. sativus] Length = 352 Score = 84.0 bits (206), Expect = 1e-17 Identities = 38/42 (90%), Positives = 40/42 (95%) Frame = -1 Query: 216 PLPEVLKNGEEAKYKQVLYSDYVKHFFRKGHDGKETIDLAKI 91 PLPEVL+NGE+A YKQVLYSDYVKHFFRKGHDGKETID AKI Sbjct: 311 PLPEVLRNGEKAMYKQVLYSDYVKHFFRKGHDGKETIDFAKI 352 >KZM90827.1 hypothetical protein DCAR_021808 [Daucus carota subsp. sativus] Length = 308 Score = 81.3 bits (199), Expect = 1e-16 Identities = 38/42 (90%), Positives = 39/42 (92%) Frame = -1 Query: 216 PLPEVLKNGEEAKYKQVLYSDYVKHFFRKGHDGKETIDLAKI 91 PL EVLKNGE+A YKQVLYSDYVKHFFRKGHDGKETID AKI Sbjct: 267 PLAEVLKNGEKAIYKQVLYSDYVKHFFRKGHDGKETIDFAKI 308 >XP_019248988.1 PREDICTED: feruloyl CoA ortho-hydroxylase 1-like [Nicotiana attenuata] OIT02346.1 feruloyl coa ortho-hydroxylase 1 [Nicotiana attenuata] Length = 360 Score = 80.9 bits (198), Expect = 2e-16 Identities = 36/42 (85%), Positives = 39/42 (92%) Frame = -1 Query: 216 PLPEVLKNGEEAKYKQVLYSDYVKHFFRKGHDGKETIDLAKI 91 PLPEV+KNGE+A YKQVLYSDYVKHFFRK HDGKET+D AKI Sbjct: 318 PLPEVIKNGEKAIYKQVLYSDYVKHFFRKAHDGKETVDFAKI 359 >XP_009588065.1 PREDICTED: feruloyl CoA ortho-hydroxylase 1-like [Nicotiana tomentosiformis] Length = 360 Score = 80.5 bits (197), Expect = 3e-16 Identities = 36/42 (85%), Positives = 39/42 (92%) Frame = -1 Query: 216 PLPEVLKNGEEAKYKQVLYSDYVKHFFRKGHDGKETIDLAKI 91 PLPEV+KNGE+A YKQVLYSDYVKHFFRK HDGKET+D AKI Sbjct: 318 PLPEVVKNGEKAIYKQVLYSDYVKHFFRKAHDGKETVDFAKI 359 >XP_016504123.1 PREDICTED: feruloyl CoA ortho-hydroxylase 1-like [Nicotiana tabacum] Length = 153 Score = 76.6 bits (187), Expect = 4e-16 Identities = 34/42 (80%), Positives = 38/42 (90%) Frame = -1 Query: 216 PLPEVLKNGEEAKYKQVLYSDYVKHFFRKGHDGKETIDLAKI 91 PLPEV+KNGE+A YKQVLYSDYVKHFFRK HDGK T+D +KI Sbjct: 111 PLPEVVKNGEKAIYKQVLYSDYVKHFFRKAHDGKVTVDFSKI 152 >KZM84736.1 hypothetical protein DCAR_027842 [Daucus carota subsp. sativus] Length = 105 Score = 74.7 bits (182), Expect = 7e-16 Identities = 33/42 (78%), Positives = 37/42 (88%) Frame = -1 Query: 216 PLPEVLKNGEEAKYKQVLYSDYVKHFFRKGHDGKETIDLAKI 91 PLPEVLKNGE+ YK VLYSDYVKHFFRK HDGK+T++ AKI Sbjct: 64 PLPEVLKNGEKPIYKSVLYSDYVKHFFRKSHDGKQTLEFAKI 105 >XP_009758809.1 PREDICTED: feruloyl CoA ortho-hydroxylase 1-like [Nicotiana sylvestris] XP_016462481.1 PREDICTED: feruloyl CoA ortho-hydroxylase 1-like [Nicotiana tabacum] Length = 360 Score = 79.0 bits (193), Expect = 1e-15 Identities = 35/42 (83%), Positives = 39/42 (92%) Frame = -1 Query: 216 PLPEVLKNGEEAKYKQVLYSDYVKHFFRKGHDGKETIDLAKI 91 PLPEV+KNGE+A YKQVLYSDYVKHFFRK H+GKET+D AKI Sbjct: 318 PLPEVIKNGEKAIYKQVLYSDYVKHFFRKAHNGKETVDFAKI 359 >XP_017223189.1 PREDICTED: feruloyl CoA ortho-hydroxylase 2-like [Daucus carota subsp. sativus] KZM84739.1 hypothetical protein DCAR_027839 [Daucus carota subsp. sativus] Length = 351 Score = 76.6 bits (187), Expect = 7e-15 Identities = 34/42 (80%), Positives = 38/42 (90%) Frame = -1 Query: 216 PLPEVLKNGEEAKYKQVLYSDYVKHFFRKGHDGKETIDLAKI 91 PLPEVLKNGE+A YK VLYSDYVKHFFRK HDGK+T++ AKI Sbjct: 310 PLPEVLKNGEKAIYKSVLYSDYVKHFFRKSHDGKQTLEFAKI 351 >CDP19904.1 unnamed protein product [Coffea canephora] Length = 358 Score = 76.3 bits (186), Expect = 1e-14 Identities = 34/42 (80%), Positives = 38/42 (90%) Frame = -1 Query: 216 PLPEVLKNGEEAKYKQVLYSDYVKHFFRKGHDGKETIDLAKI 91 PLPEVL++GE+ YKQVLYSDYVKHFFRK HDGKET+D AKI Sbjct: 317 PLPEVLESGEKPIYKQVLYSDYVKHFFRKAHDGKETVDFAKI 358 >XP_006368541.1 hypothetical protein POPTR_0001s04390g [Populus trichocarpa] ERP65110.1 hypothetical protein POPTR_0001s04390g [Populus trichocarpa] Length = 343 Score = 75.5 bits (184), Expect = 2e-14 Identities = 34/42 (80%), Positives = 38/42 (90%) Frame = -1 Query: 216 PLPEVLKNGEEAKYKQVLYSDYVKHFFRKGHDGKETIDLAKI 91 P PEVL +GE+A YK+VLYSDYVKHFFRK HDGK+TIDLAKI Sbjct: 302 PFPEVLASGEKAVYKEVLYSDYVKHFFRKAHDGKKTIDLAKI 343 >XP_019155677.1 PREDICTED: feruloyl CoA ortho-hydroxylase 1-like [Ipomoea nil] Length = 358 Score = 75.5 bits (184), Expect = 2e-14 Identities = 33/42 (78%), Positives = 38/42 (90%) Frame = -1 Query: 216 PLPEVLKNGEEAKYKQVLYSDYVKHFFRKGHDGKETIDLAKI 91 PLPE+L++GE+A YK VLYSDYVKHFFRK HDGKET+D AKI Sbjct: 316 PLPELLESGEKAVYKNVLYSDYVKHFFRKAHDGKETVDFAKI 357 >XP_016474847.1 PREDICTED: feruloyl CoA ortho-hydroxylase 1-like [Nicotiana tabacum] Length = 358 Score = 75.5 bits (184), Expect = 2e-14 Identities = 34/42 (80%), Positives = 37/42 (88%) Frame = -1 Query: 216 PLPEVLKNGEEAKYKQVLYSDYVKHFFRKGHDGKETIDLAKI 91 PL EVL+NGEE YKQVLYSDYVKHFFRK HDGK+T+D AKI Sbjct: 316 PLAEVLENGEEPIYKQVLYSDYVKHFFRKAHDGKDTVDFAKI 357 >XP_009763424.1 PREDICTED: feruloyl CoA ortho-hydroxylase 2-like [Nicotiana sylvestris] Length = 358 Score = 75.5 bits (184), Expect = 2e-14 Identities = 34/42 (80%), Positives = 37/42 (88%) Frame = -1 Query: 216 PLPEVLKNGEEAKYKQVLYSDYVKHFFRKGHDGKETIDLAKI 91 PL EVL+NGEE YKQVLYSDYVKHFFRK HDGK+T+D AKI Sbjct: 316 PLAEVLENGEEPIYKQVLYSDYVKHFFRKAHDGKDTVDFAKI 357 >XP_019257579.1 PREDICTED: feruloyl CoA ortho-hydroxylase 2-like [Nicotiana attenuata] AIR07875.1 F6'H1 [Nicotiana attenuata] OIS96510.1 feruloyl coa ortho-hydroxylase 2 [Nicotiana attenuata] Length = 358 Score = 75.5 bits (184), Expect = 2e-14 Identities = 34/42 (80%), Positives = 37/42 (88%) Frame = -1 Query: 216 PLPEVLKNGEEAKYKQVLYSDYVKHFFRKGHDGKETIDLAKI 91 PL EVL+NGEE YKQVLYSDYVKHFFRK HDGK+T+D AKI Sbjct: 316 PLAEVLENGEEPIYKQVLYSDYVKHFFRKAHDGKDTVDFAKI 357 >BAL22345.1 oxidoreductase [Ipomoea batatas] Length = 358 Score = 75.5 bits (184), Expect = 2e-14 Identities = 33/42 (78%), Positives = 38/42 (90%) Frame = -1 Query: 216 PLPEVLKNGEEAKYKQVLYSDYVKHFFRKGHDGKETIDLAKI 91 PLPE+L++GE+A YK VLYSDYVKHFFRK HDGKET+D AKI Sbjct: 316 PLPELLESGEKAVYKNVLYSDYVKHFFRKAHDGKETVDFAKI 357 >BAL22344.1 oxidoreductase [Ipomoea batatas] Length = 358 Score = 75.5 bits (184), Expect = 2e-14 Identities = 33/42 (78%), Positives = 38/42 (90%) Frame = -1 Query: 216 PLPEVLKNGEEAKYKQVLYSDYVKHFFRKGHDGKETIDLAKI 91 PLPE+L++GE+A YK VLYSDYVKHFFRK HDGKET+D AKI Sbjct: 316 PLPELLESGEKAVYKNVLYSDYVKHFFRKAHDGKETVDFAKI 357 >BAL22343.1 oxidoreductase [Ipomoea batatas] Length = 358 Score = 75.5 bits (184), Expect = 2e-14 Identities = 33/42 (78%), Positives = 38/42 (90%) Frame = -1 Query: 216 PLPEVLKNGEEAKYKQVLYSDYVKHFFRKGHDGKETIDLAKI 91 PLPE+L++GE+A YK VLYSDYVKHFFRK HDGKET+D AKI Sbjct: 316 PLPELLESGEKAVYKNVLYSDYVKHFFRKAHDGKETVDFAKI 357 >XP_002299115.2 oxidoreductase family protein [Populus trichocarpa] EEE83920.2 oxidoreductase family protein [Populus trichocarpa] Length = 358 Score = 75.1 bits (183), Expect = 3e-14 Identities = 34/42 (80%), Positives = 37/42 (88%) Frame = -1 Query: 216 PLPEVLKNGEEAKYKQVLYSDYVKHFFRKGHDGKETIDLAKI 91 P PEVL GE+A YK+VLYSDYVKHFFRK HDGK+TIDLAKI Sbjct: 317 PFPEVLAGGEKAVYKEVLYSDYVKHFFRKAHDGKKTIDLAKI 358 >XP_011048230.1 PREDICTED: feruloyl CoA ortho-hydroxylase 1-like [Populus euphratica] Length = 358 Score = 74.7 bits (182), Expect = 4e-14 Identities = 33/42 (78%), Positives = 38/42 (90%) Frame = -1 Query: 216 PLPEVLKNGEEAKYKQVLYSDYVKHFFRKGHDGKETIDLAKI 91 P PEVL +GE+A YK+VLYSDYVKHFFRK HDGK+TID+AKI Sbjct: 317 PFPEVLASGEKAVYKEVLYSDYVKHFFRKAHDGKKTIDMAKI 358 >XP_008218314.1 PREDICTED: feruloyl CoA ortho-hydroxylase 1-like [Prunus mume] Length = 359 Score = 74.7 bits (182), Expect = 4e-14 Identities = 34/42 (80%), Positives = 37/42 (88%) Frame = -1 Query: 216 PLPEVLKNGEEAKYKQVLYSDYVKHFFRKGHDGKETIDLAKI 91 PLPEVL +GE+A YKQVLYSDYVKHFFRK HDGK TI+ AKI Sbjct: 318 PLPEVLASGEKAVYKQVLYSDYVKHFFRKAHDGKSTIEFAKI 359