BLASTX nr result
ID: Angelica27_contig00030078
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00030078 (632 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017239440.1 PREDICTED: UDP-arabinose 4-epimerase 1-like [Dauc... 72 9e-19 XP_018507135.1 PREDICTED: UDP-arabinose 4-epimerase 1-like isofo... 64 7e-13 XP_018507134.1 PREDICTED: UDP-arabinose 4-epimerase 1-like isofo... 64 7e-13 XP_008378354.1 PREDICTED: UDP-arabinose 4-epimerase 1-like [Malu... 64 1e-12 XP_006357885.1 PREDICTED: UDP-arabinose 4-epimerase 1-like [Sola... 69 2e-12 XP_016580432.1 PREDICTED: UDP-arabinose 4-epimerase 1-like isofo... 67 2e-12 XP_004243634.1 PREDICTED: UDP-arabinose 4-epimerase 1 [Solanum l... 67 5e-12 XP_013463085.1 UDP-D-glucose/UDP-D-galactose 4-epimerase [Medica... 70 6e-11 GAU41520.1 hypothetical protein TSUD_302590 [Trifolium subterran... 70 1e-10 XP_013463086.1 UDP-D-glucose/UDP-D-galactose 4-epimerase [Medica... 70 1e-10 XP_004486510.1 PREDICTED: UDP-arabinose 4-epimerase 1 [Cicer ari... 70 1e-10 KYP62553.1 UDP-arabinose 4-epimerase 1 [Cajanus cajan] 70 1e-10 XP_013638487.1 PREDICTED: UDP-arabinose 4-epimerase 1 [Brassica ... 70 1e-10 XP_009115120.1 PREDICTED: UDP-arabinose 4-epimerase 1 [Brassica ... 70 1e-10 XP_018477035.1 PREDICTED: UDP-arabinose 4-epimerase 1 [Raphanus ... 70 1e-10 CDY02312.1 BnaA09g25900D [Brassica napus] 70 1e-10 CDY09555.1 BnaC05g23640D [Brassica napus] 70 1e-10 XP_006305097.1 hypothetical protein CARUB_v10009466mg [Capsella ... 70 2e-10 XP_017248419.1 PREDICTED: UDP-arabinose 4-epimerase 1-like [Dauc... 69 2e-10 OIV91796.1 hypothetical protein TanjilG_14375 [Lupinus angustifo... 69 2e-10 >XP_017239440.1 PREDICTED: UDP-arabinose 4-epimerase 1-like [Daucus carota subsp. sativus] KZN01083.1 hypothetical protein DCAR_009837 [Daucus carota subsp. sativus] Length = 396 Score = 72.4 bits (176), Expect(2) = 9e-19 Identities = 34/37 (91%), Positives = 36/37 (97%) Frame = -1 Query: 254 QFTVHEPGVTHVLVTEGAGYIGSHASLRLLKESYRVT 144 QF+VHEPGVTHVLVT GAGYIGSHASLRLLK+SYRVT Sbjct: 41 QFSVHEPGVTHVLVTGGAGYIGSHASLRLLKDSYRVT 77 Score = 48.9 bits (115), Expect(2) = 9e-19 Identities = 26/41 (63%), Positives = 30/41 (73%) Frame = -3 Query: 489 MDIMDSRQRSKISVILMLIVGVATLCIIYLKSTSNPSRPVQ 367 MDIMDSR+R K S +ML VGVATL IIY KS+S + P Q Sbjct: 1 MDIMDSRRRKKFSGKVMLTVGVATLFIIYFKSSSKVTSPKQ 41 >XP_018507135.1 PREDICTED: UDP-arabinose 4-epimerase 1-like isoform X2 [Pyrus x bretschneideri] Length = 390 Score = 63.9 bits (154), Expect(2) = 7e-13 Identities = 29/36 (80%), Positives = 33/36 (91%) Frame = -1 Query: 251 FTVHEPGVTHVLVTEGAGYIGSHASLRLLKESYRVT 144 F+ HE G+THVLVT GAGYIGSHA+LRLLK+SYRVT Sbjct: 43 FSYHEAGITHVLVTGGAGYIGSHAALRLLKDSYRVT 78 Score = 37.4 bits (85), Expect(2) = 7e-13 Identities = 17/42 (40%), Positives = 26/42 (61%) Frame = -3 Query: 489 MDIMDSRQRSKISVILMLIVGVATLCIIYLKSTSNPSRPVQV 364 MDI DS++RSK S + G+ TLCI+ K + + S P ++ Sbjct: 1 MDIADSKRRSKFSGKIFAAAGLITLCIVLFKQSHDSSSPNKI 42 >XP_018507134.1 PREDICTED: UDP-arabinose 4-epimerase 1-like isoform X1 [Pyrus x bretschneideri] Length = 389 Score = 64.3 bits (155), Expect(2) = 7e-13 Identities = 29/37 (78%), Positives = 34/37 (91%) Frame = -1 Query: 254 QFTVHEPGVTHVLVTEGAGYIGSHASLRLLKESYRVT 144 +F+ HE G+THVLVT GAGYIGSHA+LRLLK+SYRVT Sbjct: 41 KFSYHEAGITHVLVTGGAGYIGSHAALRLLKDSYRVT 77 Score = 37.0 bits (84), Expect(2) = 7e-13 Identities = 17/39 (43%), Positives = 24/39 (61%) Frame = -3 Query: 489 MDIMDSRQRSKISVILMLIVGVATLCIIYLKSTSNPSRP 373 MDI DS++RSK S + G+ TLCI+ K + + S P Sbjct: 1 MDIADSKRRSKFSGKIFAAAGLITLCIVLFKQSHDSSSP 39 >XP_008378354.1 PREDICTED: UDP-arabinose 4-epimerase 1-like [Malus domestica] Length = 389 Score = 63.5 bits (153), Expect(2) = 1e-12 Identities = 29/37 (78%), Positives = 33/37 (89%) Frame = -1 Query: 254 QFTVHEPGVTHVLVTEGAGYIGSHASLRLLKESYRVT 144 +F+ HE G+THVLVT GAGYIGSHA LRLLK+SYRVT Sbjct: 41 KFSYHEAGITHVLVTGGAGYIGSHAXLRLLKDSYRVT 77 Score = 37.0 bits (84), Expect(2) = 1e-12 Identities = 17/39 (43%), Positives = 24/39 (61%) Frame = -3 Query: 489 MDIMDSRQRSKISVILMLIVGVATLCIIYLKSTSNPSRP 373 MDI DS++RSK S + G+ TLCI+ K + + S P Sbjct: 1 MDIADSKRRSKFSGKIFAAAGLITLCIVLFKQSHDSSSP 39 >XP_006357885.1 PREDICTED: UDP-arabinose 4-epimerase 1-like [Solanum tuberosum] Length = 388 Score = 68.6 bits (166), Expect(2) = 2e-12 Identities = 32/37 (86%), Positives = 35/37 (94%) Frame = -1 Query: 254 QFTVHEPGVTHVLVTEGAGYIGSHASLRLLKESYRVT 144 +F+ HEPGVTHVLVT GAGYIGSHASLRLLK+SYRVT Sbjct: 41 KFSQHEPGVTHVLVTGGAGYIGSHASLRLLKDSYRVT 77 Score = 31.6 bits (70), Expect(2) = 2e-12 Identities = 13/41 (31%), Positives = 27/41 (65%) Frame = -3 Query: 489 MDIMDSRQRSKISVILMLIVGVATLCIIYLKSTSNPSRPVQ 367 MD ++ ++RS S L+L+ G+A +C+ +++S+ S V+ Sbjct: 1 MDFVELKRRSSTSRRLLLLAGIAAICLFIFRNSSSFSTSVK 41 >XP_016580432.1 PREDICTED: UDP-arabinose 4-epimerase 1-like isoform X1 [Capsicum annuum] Length = 388 Score = 67.4 bits (163), Expect(2) = 2e-12 Identities = 31/37 (83%), Positives = 35/37 (94%) Frame = -1 Query: 254 QFTVHEPGVTHVLVTEGAGYIGSHASLRLLKESYRVT 144 +F+ HEPGVTHVLVT GAGYIGSHA+LRLLK+SYRVT Sbjct: 41 KFSQHEPGVTHVLVTGGAGYIGSHATLRLLKDSYRVT 77 Score = 32.3 bits (72), Expect(2) = 2e-12 Identities = 13/41 (31%), Positives = 28/41 (68%) Frame = -3 Query: 489 MDIMDSRQRSKISVILMLIVGVATLCIIYLKSTSNPSRPVQ 367 MD ++ ++RS S L+L+ G+A +C++ +++S+ S V+ Sbjct: 1 MDFVELKRRSSTSRRLLLLAGIAAICLLIFRNSSSFSTSVK 41 >XP_004243634.1 PREDICTED: UDP-arabinose 4-epimerase 1 [Solanum lycopersicum] XP_015080641.1 PREDICTED: UDP-arabinose 4-epimerase 1-like [Solanum pennellii] XP_015080642.1 PREDICTED: UDP-arabinose 4-epimerase 1-like [Solanum pennellii] XP_015080643.1 PREDICTED: UDP-arabinose 4-epimerase 1-like [Solanum pennellii] Length = 388 Score = 67.0 bits (162), Expect(2) = 5e-12 Identities = 31/37 (83%), Positives = 35/37 (94%) Frame = -1 Query: 254 QFTVHEPGVTHVLVTEGAGYIGSHASLRLLKESYRVT 144 +F+ HEPGVTHVLVT GAG+IGSHASLRLLK+SYRVT Sbjct: 41 KFSQHEPGVTHVLVTGGAGFIGSHASLRLLKDSYRVT 77 Score = 31.6 bits (70), Expect(2) = 5e-12 Identities = 13/41 (31%), Positives = 27/41 (65%) Frame = -3 Query: 489 MDIMDSRQRSKISVILMLIVGVATLCIIYLKSTSNPSRPVQ 367 MD ++ ++RS S L+L+ G+A +C+ +++S+ S V+ Sbjct: 1 MDFVELKRRSSTSRRLLLLAGIAAICLFIFRNSSSFSTSVK 41 >XP_013463085.1 UDP-D-glucose/UDP-D-galactose 4-epimerase [Medicago truncatula] KEH37131.1 UDP-D-glucose/UDP-D-galactose 4-epimerase [Medicago truncatula] Length = 301 Score = 70.5 bits (171), Expect = 6e-11 Identities = 33/36 (91%), Positives = 35/36 (97%) Frame = -1 Query: 251 FTVHEPGVTHVLVTEGAGYIGSHASLRLLKESYRVT 144 F+VHEPGVTHVLVT GAGYIGSHA+LRLLKESYRVT Sbjct: 63 FSVHEPGVTHVLVTGGAGYIGSHATLRLLKESYRVT 98 >GAU41520.1 hypothetical protein TSUD_302590 [Trifolium subterraneum] Length = 412 Score = 70.5 bits (171), Expect = 1e-10 Identities = 33/36 (91%), Positives = 35/36 (97%) Frame = -1 Query: 251 FTVHEPGVTHVLVTEGAGYIGSHASLRLLKESYRVT 144 F+VHEPGVTHVLVT GAGYIGSHA+LRLLKESYRVT Sbjct: 63 FSVHEPGVTHVLVTGGAGYIGSHATLRLLKESYRVT 98 >XP_013463086.1 UDP-D-glucose/UDP-D-galactose 4-epimerase [Medicago truncatula] KEH37130.1 UDP-D-glucose/UDP-D-galactose 4-epimerase [Medicago truncatula] Length = 412 Score = 70.5 bits (171), Expect = 1e-10 Identities = 33/36 (91%), Positives = 35/36 (97%) Frame = -1 Query: 251 FTVHEPGVTHVLVTEGAGYIGSHASLRLLKESYRVT 144 F+VHEPGVTHVLVT GAGYIGSHA+LRLLKESYRVT Sbjct: 63 FSVHEPGVTHVLVTGGAGYIGSHATLRLLKESYRVT 98 >XP_004486510.1 PREDICTED: UDP-arabinose 4-epimerase 1 [Cicer arietinum] XP_012570129.1 PREDICTED: UDP-arabinose 4-epimerase 1 [Cicer arietinum] Length = 415 Score = 70.5 bits (171), Expect = 1e-10 Identities = 33/36 (91%), Positives = 35/36 (97%) Frame = -1 Query: 251 FTVHEPGVTHVLVTEGAGYIGSHASLRLLKESYRVT 144 F+VHEPGVTHVLVT GAGYIGSHA+LRLLKESYRVT Sbjct: 63 FSVHEPGVTHVLVTGGAGYIGSHATLRLLKESYRVT 98 >KYP62553.1 UDP-arabinose 4-epimerase 1 [Cajanus cajan] Length = 415 Score = 70.1 bits (170), Expect = 1e-10 Identities = 32/36 (88%), Positives = 35/36 (97%) Frame = -1 Query: 251 FTVHEPGVTHVLVTEGAGYIGSHASLRLLKESYRVT 144 F++HEPGVTHVLVT GAGYIGSHA+LRLLKESYRVT Sbjct: 63 FSIHEPGVTHVLVTGGAGYIGSHATLRLLKESYRVT 98 >XP_013638487.1 PREDICTED: UDP-arabinose 4-epimerase 1 [Brassica oleracea var. oleracea] XP_013703392.1 PREDICTED: UDP-arabinose 4-epimerase 1 [Brassica napus] Length = 419 Score = 70.1 bits (170), Expect = 1e-10 Identities = 32/36 (88%), Positives = 35/36 (97%) Frame = -1 Query: 251 FTVHEPGVTHVLVTEGAGYIGSHASLRLLKESYRVT 144 F++HEPGVTHVLVT GAGYIGSHA+LRLLKESYRVT Sbjct: 63 FSIHEPGVTHVLVTGGAGYIGSHAALRLLKESYRVT 98 >XP_009115120.1 PREDICTED: UDP-arabinose 4-epimerase 1 [Brassica rapa] XP_009115121.1 PREDICTED: UDP-arabinose 4-epimerase 1 [Brassica rapa] XP_013662441.1 PREDICTED: UDP-arabinose 4-epimerase 1-like [Brassica napus] XP_013662442.1 PREDICTED: UDP-arabinose 4-epimerase 1-like [Brassica napus] Length = 419 Score = 70.1 bits (170), Expect = 1e-10 Identities = 32/36 (88%), Positives = 35/36 (97%) Frame = -1 Query: 251 FTVHEPGVTHVLVTEGAGYIGSHASLRLLKESYRVT 144 F++HEPGVTHVLVT GAGYIGSHA+LRLLKESYRVT Sbjct: 63 FSIHEPGVTHVLVTGGAGYIGSHAALRLLKESYRVT 98 >XP_018477035.1 PREDICTED: UDP-arabinose 4-epimerase 1 [Raphanus sativus] XP_018477063.1 PREDICTED: UDP-arabinose 4-epimerase 1 [Raphanus sativus] XP_018478912.1 PREDICTED: UDP-arabinose 4-epimerase 1 [Raphanus sativus] XP_018478981.1 PREDICTED: UDP-arabinose 4-epimerase 1 [Raphanus sativus] Length = 420 Score = 70.1 bits (170), Expect = 1e-10 Identities = 32/36 (88%), Positives = 35/36 (97%) Frame = -1 Query: 251 FTVHEPGVTHVLVTEGAGYIGSHASLRLLKESYRVT 144 F++HEPGVTHVLVT GAGYIGSHA+LRLLKESYRVT Sbjct: 63 FSIHEPGVTHVLVTGGAGYIGSHAALRLLKESYRVT 98 >CDY02312.1 BnaA09g25900D [Brassica napus] Length = 420 Score = 70.1 bits (170), Expect = 1e-10 Identities = 32/36 (88%), Positives = 35/36 (97%) Frame = -1 Query: 251 FTVHEPGVTHVLVTEGAGYIGSHASLRLLKESYRVT 144 F++HEPGVTHVLVT GAGYIGSHA+LRLLKESYRVT Sbjct: 63 FSIHEPGVTHVLVTGGAGYIGSHAALRLLKESYRVT 98 >CDY09555.1 BnaC05g23640D [Brassica napus] Length = 420 Score = 70.1 bits (170), Expect = 1e-10 Identities = 32/36 (88%), Positives = 35/36 (97%) Frame = -1 Query: 251 FTVHEPGVTHVLVTEGAGYIGSHASLRLLKESYRVT 144 F++HEPGVTHVLVT GAGYIGSHA+LRLLKESYRVT Sbjct: 63 FSIHEPGVTHVLVTGGAGYIGSHAALRLLKESYRVT 98 >XP_006305097.1 hypothetical protein CARUB_v10009466mg [Capsella rubella] XP_006305098.1 hypothetical protein CARUB_v10009466mg [Capsella rubella] XP_006305099.1 hypothetical protein CARUB_v10009466mg [Capsella rubella] EOA37995.1 hypothetical protein CARUB_v10009466mg [Capsella rubella] EOA37996.1 hypothetical protein CARUB_v10009466mg [Capsella rubella] EOA37997.1 hypothetical protein CARUB_v10009466mg [Capsella rubella] Length = 376 Score = 69.7 bits (169), Expect = 2e-10 Identities = 33/37 (89%), Positives = 35/37 (94%) Frame = -1 Query: 254 QFTVHEPGVTHVLVTEGAGYIGSHASLRLLKESYRVT 144 QF+ HEPGVTHVLVT GAGYIGSHA+LRLLKESYRVT Sbjct: 20 QFSRHEPGVTHVLVTGGAGYIGSHAALRLLKESYRVT 56 >XP_017248419.1 PREDICTED: UDP-arabinose 4-epimerase 1-like [Daucus carota subsp. sativus] XP_017248420.1 PREDICTED: UDP-arabinose 4-epimerase 1-like [Daucus carota subsp. sativus] XP_017248421.1 PREDICTED: UDP-arabinose 4-epimerase 1-like [Daucus carota subsp. sativus] KZM99304.1 hypothetical protein DCAR_013334 [Daucus carota subsp. sativus] Length = 391 Score = 69.3 bits (168), Expect = 2e-10 Identities = 32/37 (86%), Positives = 35/37 (94%) Frame = -1 Query: 254 QFTVHEPGVTHVLVTEGAGYIGSHASLRLLKESYRVT 144 +F+VHEPGVTHVLVT GAGYIGSHASLRLLK+ YRVT Sbjct: 41 RFSVHEPGVTHVLVTGGAGYIGSHASLRLLKDQYRVT 77 >OIV91796.1 hypothetical protein TanjilG_14375 [Lupinus angustifolius] Length = 394 Score = 69.3 bits (168), Expect = 2e-10 Identities = 32/36 (88%), Positives = 35/36 (97%) Frame = -1 Query: 251 FTVHEPGVTHVLVTEGAGYIGSHASLRLLKESYRVT 144 F+VHEPGVTHVLVT GAGYIGSHA+LRLLK+SYRVT Sbjct: 42 FSVHEPGVTHVLVTGGAGYIGSHATLRLLKDSYRVT 77