BLASTX nr result
ID: Angelica27_contig00030020
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00030020 (221 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017216329.1 PREDICTED: uncharacterized protein LOC108193974 i... 79 2e-17 XP_017216328.1 PREDICTED: uncharacterized protein LOC108193974 i... 79 3e-17 KZM87233.1 hypothetical protein DCAR_024367 [Daucus carota subsp... 79 2e-16 XP_017216558.1 PREDICTED: non-structural maintenance of chromoso... 79 6e-16 KZM87234.1 hypothetical protein DCAR_024368 [Daucus carota subsp... 79 9e-16 XP_006354180.1 PREDICTED: non-structural maintenance of chromoso... 62 1e-09 XP_015071177.1 PREDICTED: non-structural maintenance of chromoso... 61 3e-09 NP_680177.2 embryo defective 1379 [Arabidopsis thaliana] AAO7390... 59 1e-08 XP_004228657.1 PREDICTED: non-structural maintenance of chromoso... 59 2e-08 XP_016577288.1 PREDICTED: non-structural maintenance of chromoso... 59 2e-08 XP_009126504.1 PREDICTED: non-structural maintenance of chromoso... 59 2e-08 CDY68639.1 BnaAnng27900D [Brassica napus] 59 2e-08 KFK26364.1 hypothetical protein AALP_AA8G239000 [Arabis alpina] 59 2e-08 XP_013721857.1 PREDICTED: non-structural maintenance of chromoso... 59 2e-08 EPS59566.1 hypothetical protein M569_15239 [Genlisea aurea] 59 2e-08 XP_006288254.1 hypothetical protein CARUB_v10001499mg [Capsella ... 59 2e-08 XP_013667237.1 PREDICTED: non-structural maintenance of chromoso... 59 2e-08 XP_013609379.1 PREDICTED: non-structural maintenance of chromoso... 59 2e-08 XP_009120724.1 PREDICTED: non-structural maintenance of chromoso... 59 2e-08 XP_013717604.1 PREDICTED: non-structural maintenance of chromoso... 59 2e-08 >XP_017216329.1 PREDICTED: uncharacterized protein LOC108193974 isoform X2 [Daucus carota subsp. sativus] Length = 118 Score = 79.3 bits (194), Expect = 2e-17 Identities = 38/39 (97%), Positives = 39/39 (100%) Frame = +1 Query: 103 MSSLSWRHHTLIQSLLSKGPLKESEFRSIFTKITANRSD 219 MSSLSWRHHTLIQSLLS+GPLKESEFRSIFTKITANRSD Sbjct: 1 MSSLSWRHHTLIQSLLSRGPLKESEFRSIFTKITANRSD 39 >XP_017216328.1 PREDICTED: uncharacterized protein LOC108193974 isoform X1 [Daucus carota subsp. sativus] Length = 141 Score = 79.3 bits (194), Expect = 3e-17 Identities = 38/39 (97%), Positives = 39/39 (100%) Frame = +1 Query: 103 MSSLSWRHHTLIQSLLSKGPLKESEFRSIFTKITANRSD 219 MSSLSWRHHTLIQSLLS+GPLKESEFRSIFTKITANRSD Sbjct: 1 MSSLSWRHHTLIQSLLSRGPLKESEFRSIFTKITANRSD 39 >KZM87233.1 hypothetical protein DCAR_024367 [Daucus carota subsp. sativus] Length = 237 Score = 79.3 bits (194), Expect = 2e-16 Identities = 38/39 (97%), Positives = 39/39 (100%) Frame = +1 Query: 103 MSSLSWRHHTLIQSLLSKGPLKESEFRSIFTKITANRSD 219 MSSLSWRHHTLIQSLLS+GPLKESEFRSIFTKITANRSD Sbjct: 1 MSSLSWRHHTLIQSLLSRGPLKESEFRSIFTKITANRSD 39 >XP_017216558.1 PREDICTED: non-structural maintenance of chromosomes element 1 homolog [Daucus carota subsp. sativus] Length = 322 Score = 79.3 bits (194), Expect = 6e-16 Identities = 38/39 (97%), Positives = 39/39 (100%) Frame = +1 Query: 103 MSSLSWRHHTLIQSLLSKGPLKESEFRSIFTKITANRSD 219 MSSLSWRHHTLIQSLLS+GPLKESEFRSIFTKITANRSD Sbjct: 1 MSSLSWRHHTLIQSLLSRGPLKESEFRSIFTKITANRSD 39 >KZM87234.1 hypothetical protein DCAR_024368 [Daucus carota subsp. sativus] Length = 387 Score = 79.3 bits (194), Expect = 9e-16 Identities = 38/39 (97%), Positives = 39/39 (100%) Frame = +1 Query: 103 MSSLSWRHHTLIQSLLSKGPLKESEFRSIFTKITANRSD 219 MSSLSWRHHTLIQSLLS+GPLKESEFRSIFTKITANRSD Sbjct: 1 MSSLSWRHHTLIQSLLSRGPLKESEFRSIFTKITANRSD 39 >XP_006354180.1 PREDICTED: non-structural maintenance of chromosomes element 1 homolog [Solanum tuberosum] Length = 314 Score = 62.0 bits (149), Expect = 1e-09 Identities = 27/34 (79%), Positives = 33/34 (97%) Frame = +1 Query: 103 MSSLSWRHHTLIQSLLSKGPLKESEFRSIFTKIT 204 M++LSWRHHTLIQ+LLS+GPLKE +F+SIFTKIT Sbjct: 1 MATLSWRHHTLIQALLSRGPLKEKDFQSIFTKIT 34 >XP_015071177.1 PREDICTED: non-structural maintenance of chromosomes element 1 homolog [Solanum pennellii] Length = 314 Score = 60.8 bits (146), Expect = 3e-09 Identities = 27/38 (71%), Positives = 33/38 (86%) Frame = +1 Query: 103 MSSLSWRHHTLIQSLLSKGPLKESEFRSIFTKITANRS 216 M++LSWRHHTLIQ+LLS+GPLKE +F+SIFTKI S Sbjct: 1 MATLSWRHHTLIQALLSRGPLKEKDFQSIFTKIIGKSS 38 >NP_680177.2 embryo defective 1379 [Arabidopsis thaliana] AAO73901.1 hypothetical protein [Arabidopsis thaliana] AAS76229.1 At5g21140 [Arabidopsis thaliana] AAS92326.1 At5g21140 [Arabidopsis thaliana] AED92939.1 embryo defective 1379 [Arabidopsis thaliana] OAO94742.1 emb1379 [Arabidopsis thaliana] Length = 312 Score = 59.3 bits (142), Expect = 1e-08 Identities = 25/34 (73%), Positives = 31/34 (91%) Frame = +1 Query: 103 MSSLSWRHHTLIQSLLSKGPLKESEFRSIFTKIT 204 M+SLSW+HHTLIQ+L+S+GPLKE EF SIFT +T Sbjct: 1 MASLSWKHHTLIQALISRGPLKEKEFHSIFTAVT 34 >XP_004228657.1 PREDICTED: non-structural maintenance of chromosomes element 1 homolog [Solanum lycopersicum] Length = 312 Score = 58.9 bits (141), Expect = 2e-08 Identities = 25/33 (75%), Positives = 32/33 (96%) Frame = +1 Query: 103 MSSLSWRHHTLIQSLLSKGPLKESEFRSIFTKI 201 M++LSWRHHTLIQ+LLS+GPLKE +F+SIFT+I Sbjct: 1 MATLSWRHHTLIQALLSRGPLKEKDFQSIFTRI 33 >XP_016577288.1 PREDICTED: non-structural maintenance of chromosomes element 1 homolog [Capsicum annuum] Length = 314 Score = 58.9 bits (141), Expect = 2e-08 Identities = 26/39 (66%), Positives = 31/39 (79%) Frame = +1 Query: 103 MSSLSWRHHTLIQSLLSKGPLKESEFRSIFTKITANRSD 219 M +LSWRHHTLIQ+LLS+GP KE +F S+FTKIT D Sbjct: 1 MPTLSWRHHTLIQALLSRGPHKEKDFHSLFTKITGKSPD 39 >XP_009126504.1 PREDICTED: non-structural maintenance of chromosomes element 1 homolog [Brassica rapa] XP_013680309.1 PREDICTED: non-structural maintenance of chromosomes element 1 homolog [Brassica napus] Length = 317 Score = 58.9 bits (141), Expect = 2e-08 Identities = 25/34 (73%), Positives = 31/34 (91%) Frame = +1 Query: 103 MSSLSWRHHTLIQSLLSKGPLKESEFRSIFTKIT 204 M+SLSW+HHTLIQ+L+S+GPLKE EF SIFT +T Sbjct: 1 MASLSWKHHTLIQALISRGPLKEKEFHSIFTGVT 34 >CDY68639.1 BnaAnng27900D [Brassica napus] Length = 317 Score = 58.9 bits (141), Expect = 2e-08 Identities = 25/34 (73%), Positives = 31/34 (91%) Frame = +1 Query: 103 MSSLSWRHHTLIQSLLSKGPLKESEFRSIFTKIT 204 M+SLSW+HHTLIQ+L+S+GPLKE EF SIFT +T Sbjct: 1 MASLSWKHHTLIQALISRGPLKEKEFHSIFTGVT 34 >KFK26364.1 hypothetical protein AALP_AA8G239000 [Arabis alpina] Length = 317 Score = 58.9 bits (141), Expect = 2e-08 Identities = 25/34 (73%), Positives = 31/34 (91%) Frame = +1 Query: 103 MSSLSWRHHTLIQSLLSKGPLKESEFRSIFTKIT 204 M+SLSW+HHTLIQ+L+S+GPLKE EF SIFT +T Sbjct: 1 MASLSWKHHTLIQALISRGPLKEKEFHSIFTGVT 34 >XP_013721857.1 PREDICTED: non-structural maintenance of chromosomes element 1 homolog [Brassica napus] Length = 318 Score = 58.9 bits (141), Expect = 2e-08 Identities = 25/34 (73%), Positives = 31/34 (91%) Frame = +1 Query: 103 MSSLSWRHHTLIQSLLSKGPLKESEFRSIFTKIT 204 M+SLSW+HHTLIQ+L+S+GPLKE EF SIFT +T Sbjct: 1 MASLSWKHHTLIQALISRGPLKEKEFHSIFTGVT 34 >EPS59566.1 hypothetical protein M569_15239 [Genlisea aurea] Length = 511 Score = 58.9 bits (141), Expect = 2e-08 Identities = 26/34 (76%), Positives = 31/34 (91%) Frame = +1 Query: 103 MSSLSWRHHTLIQSLLSKGPLKESEFRSIFTKIT 204 M L+WRHHTLIQ+LLSKGPLKE +FRSIF++IT Sbjct: 26 MPPLNWRHHTLIQTLLSKGPLKEDDFRSIFSQIT 59 >XP_006288254.1 hypothetical protein CARUB_v10001499mg [Capsella rubella] EOA21152.1 hypothetical protein CARUB_v10001499mg [Capsella rubella] Length = 315 Score = 58.5 bits (140), Expect = 2e-08 Identities = 25/34 (73%), Positives = 31/34 (91%) Frame = +1 Query: 103 MSSLSWRHHTLIQSLLSKGPLKESEFRSIFTKIT 204 M+SLSW+HHTLIQ+L+S+GPLKE EF SIFT +T Sbjct: 1 MASLSWKHHTLIQALISRGPLKEREFHSIFTGVT 34 >XP_013667237.1 PREDICTED: non-structural maintenance of chromosomes element 1 homolog [Brassica napus] Length = 316 Score = 58.5 bits (140), Expect = 2e-08 Identities = 25/34 (73%), Positives = 31/34 (91%) Frame = +1 Query: 103 MSSLSWRHHTLIQSLLSKGPLKESEFRSIFTKIT 204 M SLSW+HHTLIQ+L+S+GPLKE EF+SIFT +T Sbjct: 1 MVSLSWKHHTLIQALISRGPLKEKEFQSIFTAVT 34 >XP_013609379.1 PREDICTED: non-structural maintenance of chromosomes element 1 homolog [Brassica oleracea var. oleracea] Length = 316 Score = 58.5 bits (140), Expect = 2e-08 Identities = 25/34 (73%), Positives = 31/34 (91%) Frame = +1 Query: 103 MSSLSWRHHTLIQSLLSKGPLKESEFRSIFTKIT 204 M SLSW+HHTLIQ+L+S+GPLKE EF+SIFT +T Sbjct: 1 MVSLSWKHHTLIQALISRGPLKEKEFQSIFTAVT 34 >XP_009120724.1 PREDICTED: non-structural maintenance of chromosomes element 1 homolog [Brassica rapa] CDX92407.1 BnaA10g14460D [Brassica napus] Length = 316 Score = 58.5 bits (140), Expect = 2e-08 Identities = 25/34 (73%), Positives = 31/34 (91%) Frame = +1 Query: 103 MSSLSWRHHTLIQSLLSKGPLKESEFRSIFTKIT 204 M SLSW+HHTLIQ+L+S+GPLKE EF+SIFT +T Sbjct: 1 MVSLSWKHHTLIQALISRGPLKEKEFQSIFTAVT 34 >XP_013717604.1 PREDICTED: non-structural maintenance of chromosomes element 1 homolog [Brassica napus] CDY59517.1 BnaCnng35070D [Brassica napus] Length = 316 Score = 58.5 bits (140), Expect = 2e-08 Identities = 25/34 (73%), Positives = 31/34 (91%) Frame = +1 Query: 103 MSSLSWRHHTLIQSLLSKGPLKESEFRSIFTKIT 204 M SLSW+HHTLIQ+L+S+GPLKE EF+SIFT +T Sbjct: 1 MVSLSWKHHTLIQALISRGPLKEKEFQSIFTAVT 34