BLASTX nr result
ID: Angelica27_contig00029994
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00029994 (484 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017235253.1 PREDICTED: paired amphipathic helix protein Sin3-... 59 3e-07 XP_017235252.1 PREDICTED: paired amphipathic helix protein Sin3-... 59 3e-07 XP_017235251.1 PREDICTED: paired amphipathic helix protein Sin3-... 59 3e-07 KZN05876.1 hypothetical protein DCAR_006713 [Daucus carota subsp... 59 3e-07 XP_017218495.1 PREDICTED: paired amphipathic helix protein Sin3-... 56 3e-06 KZM88285.1 hypothetical protein DCAR_025360 [Daucus carota subsp... 56 3e-06 >XP_017235253.1 PREDICTED: paired amphipathic helix protein Sin3-like 2 isoform X3 [Daucus carota subsp. sativus] Length = 1365 Score = 59.3 bits (142), Expect = 3e-07 Identities = 28/41 (68%), Positives = 33/41 (80%) Frame = -1 Query: 484 YVLDTEDVFCRKRCKREQSATLSDQEKRRVQKFHQFLTVSI 362 YVLDTED FCRKR KRE++ T QE+ +VQKFHQFL+ SI Sbjct: 1325 YVLDTEDFFCRKRYKREKAFTSPIQERGKVQKFHQFLSASI 1365 >XP_017235252.1 PREDICTED: paired amphipathic helix protein Sin3-like 2 isoform X2 [Daucus carota subsp. sativus] Length = 1376 Score = 59.3 bits (142), Expect = 3e-07 Identities = 28/41 (68%), Positives = 33/41 (80%) Frame = -1 Query: 484 YVLDTEDVFCRKRCKREQSATLSDQEKRRVQKFHQFLTVSI 362 YVLDTED FCRKR KRE++ T QE+ +VQKFHQFL+ SI Sbjct: 1336 YVLDTEDFFCRKRYKREKAFTSPIQERGKVQKFHQFLSASI 1376 >XP_017235251.1 PREDICTED: paired amphipathic helix protein Sin3-like 2 isoform X1 [Daucus carota subsp. sativus] Length = 1377 Score = 59.3 bits (142), Expect = 3e-07 Identities = 28/41 (68%), Positives = 33/41 (80%) Frame = -1 Query: 484 YVLDTEDVFCRKRCKREQSATLSDQEKRRVQKFHQFLTVSI 362 YVLDTED FCRKR KRE++ T QE+ +VQKFHQFL+ SI Sbjct: 1337 YVLDTEDFFCRKRYKREKAFTSPIQERGKVQKFHQFLSASI 1377 >KZN05876.1 hypothetical protein DCAR_006713 [Daucus carota subsp. sativus] Length = 1383 Score = 59.3 bits (142), Expect = 3e-07 Identities = 28/41 (68%), Positives = 33/41 (80%) Frame = -1 Query: 484 YVLDTEDVFCRKRCKREQSATLSDQEKRRVQKFHQFLTVSI 362 YVLDTED FCRKR KRE++ T QE+ +VQKFHQFL+ SI Sbjct: 1343 YVLDTEDFFCRKRYKREKAFTSPIQERGKVQKFHQFLSASI 1383 >XP_017218495.1 PREDICTED: paired amphipathic helix protein Sin3-like 2 [Daucus carota subsp. sativus] Length = 1333 Score = 56.2 bits (134), Expect = 3e-06 Identities = 28/41 (68%), Positives = 33/41 (80%) Frame = -1 Query: 484 YVLDTEDVFCRKRCKREQSATLSDQEKRRVQKFHQFLTVSI 362 YVLDTED+FCRKR K E+S+TL Q+ +V KFHQFLT SI Sbjct: 1294 YVLDTEDIFCRKRSKIEKSSTLL-QDGAKVHKFHQFLTASI 1333 >KZM88285.1 hypothetical protein DCAR_025360 [Daucus carota subsp. sativus] Length = 1362 Score = 56.2 bits (134), Expect = 3e-06 Identities = 28/41 (68%), Positives = 33/41 (80%) Frame = -1 Query: 484 YVLDTEDVFCRKRCKREQSATLSDQEKRRVQKFHQFLTVSI 362 YVLDTED+FCRKR K E+S+TL Q+ +V KFHQFLT SI Sbjct: 1323 YVLDTEDIFCRKRSKIEKSSTLL-QDGAKVHKFHQFLTASI 1362