BLASTX nr result
ID: Angelica27_contig00029897
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00029897 (727 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ONI18665.1 hypothetical protein PRUPE_3G231500 [Prunus persica] 54 3e-06 >ONI18665.1 hypothetical protein PRUPE_3G231500 [Prunus persica] Length = 83 Score = 53.9 bits (128), Expect = 3e-06 Identities = 23/35 (65%), Positives = 29/35 (82%) Frame = +2 Query: 2 PVMIESTGMRCGGSRTLFTGRTTCRNHISYDITGF 106 P+MI+S +RCGG+ TLF+GRT R+HISYDI GF Sbjct: 48 PMMIQSACLRCGGAETLFSGRTPRRSHISYDINGF 82