BLASTX nr result
ID: Angelica27_contig00028459
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00028459 (570 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017223438.1 PREDICTED: putative methylesterase 11, chloroplas... 62 5e-08 >XP_017223438.1 PREDICTED: putative methylesterase 11, chloroplastic [Daucus carota subsp. sativus] KZM85900.1 hypothetical protein DCAR_026678 [Daucus carota subsp. sativus] Length = 396 Score = 62.0 bits (149), Expect = 5e-08 Identities = 31/41 (75%), Positives = 32/41 (78%), Gaps = 3/41 (7%) Frame = -2 Query: 164 MGNSLTCFAPKERPEKASK---WSQSPYSFIGSSVQKKDTT 51 MGNSLTCFAPK+ EK SK WSQSP FIGSSV KKDTT Sbjct: 1 MGNSLTCFAPKDLTEKGSKGSRWSQSPLKFIGSSVHKKDTT 41