BLASTX nr result
ID: Angelica27_contig00028442
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00028442 (328 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_006852230.1 PREDICTED: cleavage and polyadenylation specifici... 53 1e-05 >XP_006852230.1 PREDICTED: cleavage and polyadenylation specificity factor subunit 6 [Amborella trichopoda] ERN13697.1 hypothetical protein AMTR_s00049p00146760 [Amborella trichopoda] Length = 659 Score = 52.8 bits (125), Expect = 1e-05 Identities = 23/33 (69%), Positives = 29/33 (87%) Frame = +3 Query: 180 SKGRSKSRMMDDDDQRPRSKDVEYNKRRRMPSD 278 S+ RSKSRMM ++DQR RSKDV+Y KRRR+PS+ Sbjct: 627 SRSRSKSRMMQEEDQRSRSKDVDYGKRRRVPSE 659