BLASTX nr result
ID: Angelica27_contig00028387
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00028387 (443 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017229036.1 PREDICTED: mannan synthase 1-like [Daucus carota ... 47 5e-07 >XP_017229036.1 PREDICTED: mannan synthase 1-like [Daucus carota subsp. sativus] Length = 523 Score = 47.4 bits (111), Expect(2) = 5e-07 Identities = 21/36 (58%), Positives = 28/36 (77%) Frame = -2 Query: 427 NIIGLVKASQVNGWIVTVKLGNSQRNQVGAPFFKSR 320 +IIGL++AS+VN W+VT KLGN + NQ FFKS+ Sbjct: 428 SIIGLLEASRVNEWVVTEKLGNRRNNQARVSFFKSK 463 Score = 33.5 bits (75), Expect(2) = 5e-07 Identities = 15/23 (65%), Positives = 16/23 (69%) Frame = -3 Query: 231 RIHKLELAMGTFMLQYAVYKMFY 163 RIHKLE MG FML AVY M + Sbjct: 469 RIHKLEFIMGIFMLHCAVYNMLH 491