BLASTX nr result
ID: Angelica27_contig00028331
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00028331 (534 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KZM94656.1 hypothetical protein DCAR_017898 [Daucus carota subsp... 71 3e-13 >KZM94656.1 hypothetical protein DCAR_017898 [Daucus carota subsp. sativus] Length = 71 Score = 70.9 bits (172), Expect = 3e-13 Identities = 32/43 (74%), Positives = 37/43 (86%), Gaps = 1/43 (2%) Frame = +1 Query: 61 NPKPKKN*HIDPSH-MPSGGSAPPRYGNINNAPTCSRTLNYVL 186 NPKPK H++PS MPSGGSAPPRYGNIN APTCSRTLN+++ Sbjct: 18 NPKPKNIQHMNPSQRMPSGGSAPPRYGNINTAPTCSRTLNHII 60