BLASTX nr result
ID: Angelica27_contig00028233
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00028233 (304 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017254740.1 PREDICTED: mannan endo-1,4-beta-mannosidase 7-lik... 54 2e-06 >XP_017254740.1 PREDICTED: mannan endo-1,4-beta-mannosidase 7-like [Daucus carota subsp. sativus] KZM90166.1 hypothetical protein DCAR_022469 [Daucus carota subsp. sativus] Length = 436 Score = 54.3 bits (129), Expect = 2e-06 Identities = 24/35 (68%), Positives = 30/35 (85%) Frame = -3 Query: 302 YARRRHMKKGDGTMNKVGIREIYPKQRHIRKIMKL 198 Y+R+RHMKKG T +KV IR++Y +QRHIRKIMKL Sbjct: 402 YSRQRHMKKGGQTRDKVEIRQVYSRQRHIRKIMKL 436