BLASTX nr result
ID: Angelica27_contig00028213
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00028213 (317 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KZN06748.1 hypothetical protein DCAR_007585 [Daucus carota subsp... 61 1e-08 XP_017236707.1 PREDICTED: lysM domain receptor-like kinase 3 [Da... 61 1e-08 >KZN06748.1 hypothetical protein DCAR_007585 [Daucus carota subsp. sativus] Length = 591 Score = 60.8 bits (146), Expect = 1e-08 Identities = 28/39 (71%), Positives = 33/39 (84%) Frame = -1 Query: 317 FTVRKNGGSVYNMVIDDYGGLGVFTYSWRAVRMGMIRKL 201 FTVRKNGGSVY+MVID+YGGLG+F+ S RA RMG + L Sbjct: 40 FTVRKNGGSVYDMVIDEYGGLGIFSNSRRAARMGSVVSL 78 >XP_017236707.1 PREDICTED: lysM domain receptor-like kinase 3 [Daucus carota subsp. sativus] Length = 650 Score = 60.8 bits (146), Expect = 1e-08 Identities = 28/39 (71%), Positives = 33/39 (84%) Frame = -1 Query: 317 FTVRKNGGSVYNMVIDDYGGLGVFTYSWRAVRMGMIRKL 201 FTVRKNGGSVY+MVID+YGGLG+F+ S RA RMG + L Sbjct: 96 FTVRKNGGSVYDMVIDEYGGLGIFSNSRRAARMGSVVSL 134