BLASTX nr result
ID: Angelica27_contig00028185
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00028185 (295 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017222835.1 PREDICTED: LIM domain-containing protein WLIM2b-l... 65 1e-10 XP_017222837.1 PREDICTED: LIM domain-containing protein WLIM2b-l... 63 8e-10 KJB53439.1 hypothetical protein B456_009G321800 [Gossypium raimo... 54 1e-07 XP_017219270.1 PREDICTED: LIM domain-containing protein WLIM2b-l... 56 2e-07 OMO76287.1 Zinc finger, LIM-type [Corchorus olitorius] 56 2e-07 EPS58831.1 hypothetical protein M569_15983, partial [Genlisea au... 56 2e-07 XP_017222838.1 PREDICTED: LIM domain-containing protein WLIM2b-l... 55 3e-07 KDO36535.1 hypothetical protein CISIN_1g034188mg [Citrus sinensis] 54 4e-07 XP_012088028.1 PREDICTED: LIM domain-containing protein WLIM2b i... 54 4e-07 XP_006423310.1 hypothetical protein CICLE_v10030332mg, partial [... 54 4e-07 OMO68422.1 Zinc finger, LIM-type [Corchorus capsularis] 55 4e-07 XP_012088022.1 PREDICTED: LIM domain-containing protein WLIM2b i... 54 5e-07 XP_019191873.1 PREDICTED: LIM domain-containing protein WLIM2b-l... 54 8e-07 XP_019260011.1 PREDICTED: LIM domain-containing protein WLIM2b-l... 54 8e-07 XP_009602682.1 PREDICTED: LIM domain-containing protein WLIM2b-l... 54 8e-07 XP_012449623.1 PREDICTED: LIM domain-containing protein WLIM2b-l... 54 8e-07 XP_011076748.1 PREDICTED: LIM domain-containing protein WLIM2b [... 54 8e-07 XP_017643682.1 PREDICTED: LIM domain-containing protein WLIM2b-l... 54 8e-07 XP_016681543.1 PREDICTED: LIM domain-containing protein WLIM2b-l... 54 8e-07 AAL38006.1 LIM domain protein [Gossypium hirsutum] AII80543.1 LI... 54 8e-07 >XP_017222835.1 PREDICTED: LIM domain-containing protein WLIM2b-like isoform X1 [Daucus carota subsp. sativus] Length = 252 Score = 65.5 bits (158), Expect = 1e-10 Identities = 32/45 (71%), Positives = 36/45 (80%) Frame = -2 Query: 135 WLLISQENLRRPRSDPSKDMSFIGTQQKCKVCEKTVYPMELLSAD 1 W+ ++LR RSD K+MSF GTQQKCKVCEKTVYPMELLSAD Sbjct: 46 WIFKLHQHLRE-RSDLRKEMSFTGTQQKCKVCEKTVYPMELLSAD 89 >XP_017222837.1 PREDICTED: LIM domain-containing protein WLIM2b-like isoform X2 [Daucus carota subsp. sativus] Length = 251 Score = 63.2 bits (152), Expect = 8e-10 Identities = 31/45 (68%), Positives = 35/45 (77%) Frame = -2 Query: 135 WLLISQENLRRPRSDPSKDMSFIGTQQKCKVCEKTVYPMELLSAD 1 W+ ++L R SD K+MSF GTQQKCKVCEKTVYPMELLSAD Sbjct: 46 WIFKLHQHLER--SDLRKEMSFTGTQQKCKVCEKTVYPMELLSAD 88 >KJB53439.1 hypothetical protein B456_009G321800 [Gossypium raimondii] Length = 78 Score = 54.3 bits (129), Expect = 1e-07 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = -2 Query: 78 MSFIGTQQKCKVCEKTVYPMELLSAD 1 MSFIGTQQKCK CEKTVYP+ELLSAD Sbjct: 1 MSFIGTQQKCKACEKTVYPVELLSAD 26 >XP_017219270.1 PREDICTED: LIM domain-containing protein WLIM2b-like [Daucus carota subsp. sativus] XP_017219271.1 PREDICTED: LIM domain-containing protein WLIM2b-like [Daucus carota subsp. sativus] XP_017219272.1 PREDICTED: LIM domain-containing protein WLIM2b-like [Daucus carota subsp. sativus] Length = 189 Score = 56.2 bits (134), Expect = 2e-07 Identities = 25/26 (96%), Positives = 26/26 (100%) Frame = -2 Query: 78 MSFIGTQQKCKVCEKTVYPMELLSAD 1 MSF+GTQQKCKVCEKTVYPMELLSAD Sbjct: 1 MSFMGTQQKCKVCEKTVYPMELLSAD 26 >OMO76287.1 Zinc finger, LIM-type [Corchorus olitorius] Length = 189 Score = 55.8 bits (133), Expect = 2e-07 Identities = 25/26 (96%), Positives = 25/26 (96%) Frame = -2 Query: 78 MSFIGTQQKCKVCEKTVYPMELLSAD 1 MSFIGTQQKCK CEKTVYPMELLSAD Sbjct: 1 MSFIGTQQKCKACEKTVYPMELLSAD 26 >EPS58831.1 hypothetical protein M569_15983, partial [Genlisea aurea] Length = 189 Score = 55.8 bits (133), Expect = 2e-07 Identities = 25/26 (96%), Positives = 26/26 (100%) Frame = -2 Query: 78 MSFIGTQQKCKVCEKTVYPMELLSAD 1 MSFIGTQQKCKVCEKTVYP+ELLSAD Sbjct: 1 MSFIGTQQKCKVCEKTVYPVELLSAD 26 >XP_017222838.1 PREDICTED: LIM domain-containing protein WLIM2b-like isoform X3 [Daucus carota subsp. sativus] Length = 189 Score = 55.5 bits (132), Expect = 3e-07 Identities = 25/26 (96%), Positives = 25/26 (96%) Frame = -2 Query: 78 MSFIGTQQKCKVCEKTVYPMELLSAD 1 MSF GTQQKCKVCEKTVYPMELLSAD Sbjct: 1 MSFTGTQQKCKVCEKTVYPMELLSAD 26 >KDO36535.1 hypothetical protein CISIN_1g034188mg [Citrus sinensis] Length = 102 Score = 53.5 bits (127), Expect = 4e-07 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = -2 Query: 78 MSFIGTQQKCKVCEKTVYPMELLSAD 1 MSFIGTQQKCKVCEKTVYP+E LSAD Sbjct: 1 MSFIGTQQKCKVCEKTVYPVEQLSAD 26 >XP_012088028.1 PREDICTED: LIM domain-containing protein WLIM2b isoform X3 [Jatropha curcas] Length = 123 Score = 53.9 bits (128), Expect = 4e-07 Identities = 24/26 (92%), Positives = 24/26 (92%) Frame = -2 Query: 78 MSFIGTQQKCKVCEKTVYPMELLSAD 1 MSF GTQQKCK CEKTVYPMELLSAD Sbjct: 1 MSFTGTQQKCKACEKTVYPMELLSAD 26 >XP_006423310.1 hypothetical protein CICLE_v10030332mg, partial [Citrus clementina] ESR36550.1 hypothetical protein CICLE_v10030332mg, partial [Citrus clementina] Length = 108 Score = 53.5 bits (127), Expect = 4e-07 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = -2 Query: 78 MSFIGTQQKCKVCEKTVYPMELLSAD 1 MSFIGTQQKCKVCEKTVYP+E LSAD Sbjct: 1 MSFIGTQQKCKVCEKTVYPVEQLSAD 26 >OMO68422.1 Zinc finger, LIM-type [Corchorus capsularis] Length = 189 Score = 55.1 bits (131), Expect = 4e-07 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = -2 Query: 78 MSFIGTQQKCKVCEKTVYPMELLSAD 1 MSF+GTQQKCK CEKTVYPMELLSAD Sbjct: 1 MSFLGTQQKCKACEKTVYPMELLSAD 26 >XP_012088022.1 PREDICTED: LIM domain-containing protein WLIM2b isoform X2 [Jatropha curcas] Length = 135 Score = 53.9 bits (128), Expect = 5e-07 Identities = 24/26 (92%), Positives = 24/26 (92%) Frame = -2 Query: 78 MSFIGTQQKCKVCEKTVYPMELLSAD 1 MSF GTQQKCK CEKTVYPMELLSAD Sbjct: 1 MSFTGTQQKCKACEKTVYPMELLSAD 26 >XP_019191873.1 PREDICTED: LIM domain-containing protein WLIM2b-like [Ipomoea nil] XP_019191875.1 PREDICTED: LIM domain-containing protein WLIM2b-like [Ipomoea nil] Length = 189 Score = 54.3 bits (129), Expect = 8e-07 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = -2 Query: 78 MSFIGTQQKCKVCEKTVYPMELLSAD 1 MSFIGTQQKCK CEKTVYP+ELLSAD Sbjct: 1 MSFIGTQQKCKACEKTVYPVELLSAD 26 >XP_019260011.1 PREDICTED: LIM domain-containing protein WLIM2b-like [Nicotiana attenuata] OIT39478.1 lim domain-containing protein wlim2b [Nicotiana attenuata] Length = 189 Score = 54.3 bits (129), Expect = 8e-07 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = -2 Query: 78 MSFIGTQQKCKVCEKTVYPMELLSAD 1 MSFIGTQQKCK CEKTVYP+ELLSAD Sbjct: 1 MSFIGTQQKCKACEKTVYPVELLSAD 26 >XP_009602682.1 PREDICTED: LIM domain-containing protein WLIM2b-like [Nicotiana tomentosiformis] XP_009602683.1 PREDICTED: LIM domain-containing protein WLIM2b-like [Nicotiana tomentosiformis] XP_009786370.1 PREDICTED: pollen-specific protein SF3-like [Nicotiana sylvestris] XP_016470248.1 PREDICTED: LIM domain-containing protein WLIM2b-like [Nicotiana tabacum] XP_016433128.1 PREDICTED: LIM domain-containing protein WLIM2b-like [Nicotiana tabacum] AAD56951.1 LIM domain protein WLIM2 [Nicotiana tabacum] CAA71891.1 LIM-domain SF3 protein [Nicotiana tabacum] Length = 189 Score = 54.3 bits (129), Expect = 8e-07 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = -2 Query: 78 MSFIGTQQKCKVCEKTVYPMELLSAD 1 MSFIGTQQKCK CEKTVYP+ELLSAD Sbjct: 1 MSFIGTQQKCKACEKTVYPVELLSAD 26 >XP_012449623.1 PREDICTED: LIM domain-containing protein WLIM2b-like [Gossypium raimondii] KJB67594.1 hypothetical protein B456_010G199200 [Gossypium raimondii] Length = 189 Score = 54.3 bits (129), Expect = 8e-07 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = -2 Query: 78 MSFIGTQQKCKVCEKTVYPMELLSAD 1 MSFIGTQQKCK CEKTVYP+ELLSAD Sbjct: 1 MSFIGTQQKCKACEKTVYPVELLSAD 26 >XP_011076748.1 PREDICTED: LIM domain-containing protein WLIM2b [Sesamum indicum] Length = 189 Score = 54.3 bits (129), Expect = 8e-07 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = -2 Query: 78 MSFIGTQQKCKVCEKTVYPMELLSAD 1 MSFIGTQQKCK CEKTVYP+ELLSAD Sbjct: 1 MSFIGTQQKCKACEKTVYPVELLSAD 26 >XP_017643682.1 PREDICTED: LIM domain-containing protein WLIM2b-like [Gossypium arboreum] KHG07853.1 Pollen-specific SF3 [Gossypium arboreum] Length = 189 Score = 54.3 bits (129), Expect = 8e-07 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = -2 Query: 78 MSFIGTQQKCKVCEKTVYPMELLSAD 1 MSFIGTQQKCK CEKTVYP+ELLSAD Sbjct: 1 MSFIGTQQKCKACEKTVYPVELLSAD 26 >XP_016681543.1 PREDICTED: LIM domain-containing protein WLIM2b-like [Gossypium hirsutum] AGJ83945.1 lim protein 5 [Gossypium hirsutum] Length = 189 Score = 54.3 bits (129), Expect = 8e-07 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = -2 Query: 78 MSFIGTQQKCKVCEKTVYPMELLSAD 1 MSFIGTQQKCK CEKTVYP+ELLSAD Sbjct: 1 MSFIGTQQKCKACEKTVYPVELLSAD 26 >AAL38006.1 LIM domain protein [Gossypium hirsutum] AII80543.1 LIM-domian protein 9 [Gossypium hirsutum] Length = 189 Score = 54.3 bits (129), Expect = 8e-07 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = -2 Query: 78 MSFIGTQQKCKVCEKTVYPMELLSAD 1 MSFIGTQQKCK CEKTVYP+ELLSAD Sbjct: 1 MSFIGTQQKCKACEKTVYPVELLSAD 26