BLASTX nr result
ID: Angelica27_contig00028000
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00028000 (384 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_008775896.1 PREDICTED: riboflavin biosynthesis protein PYRR, ... 60 4e-08 XP_010268307.1 PREDICTED: riboflavin biosynthesis protein PYRR, ... 60 7e-08 XP_010268306.1 PREDICTED: riboflavin biosynthesis protein PYRR, ... 60 7e-08 XP_010268305.1 PREDICTED: riboflavin biosynthesis protein PYRR, ... 60 7e-08 XP_010268304.1 PREDICTED: riboflavin biosynthesis protein PYRR, ... 60 7e-08 XP_010268302.1 PREDICTED: riboflavin biosynthesis protein PYRR, ... 60 7e-08 KFK34036.1 hypothetical protein AALP_AA5G093600 [Arabis alpina] 59 1e-07 XP_010907914.1 PREDICTED: riboflavin biosynthesis protein PYRR, ... 59 1e-07 KMZ65220.1 Diaminohydroxyphosphoribosylaminopyrimidine deaminase... 58 2e-07 BAS78634.1 Os02g0473000, partial [Oryza sativa Japonica Group] 57 3e-07 XP_003631864.1 PREDICTED: riboflavin biosynthesis protein PYRR, ... 58 3e-07 CAN60371.1 hypothetical protein VITISV_041263 [Vitis vinifera] 58 3e-07 OMO50536.1 CMP/dCMP deaminase, zinc-binding protein [Corchorus o... 58 3e-07 OMO77970.1 CMP/dCMP deaminase, zinc-binding protein [Corchorus c... 58 3e-07 XP_019075163.1 PREDICTED: riboflavin biosynthesis protein PYRR, ... 58 3e-07 KZV47660.1 riboflavin biosynthesis protein PYRR, chloroplastic-l... 58 3e-07 XP_011077162.1 PREDICTED: riboflavin biosynthesis protein PYRR, ... 58 3e-07 XP_006428600.1 hypothetical protein CICLE_v10011346mg [Citrus cl... 57 4e-07 XP_015688811.1 PREDICTED: riboflavin biosynthesis protein PYRR, ... 57 4e-07 BAG89528.1 unnamed protein product [Oryza sativa Japonica Group] 57 4e-07 >XP_008775896.1 PREDICTED: riboflavin biosynthesis protein PYRR, chloroplastic [Phoenix dactylifera] Length = 620 Score = 60.5 bits (145), Expect = 4e-08 Identities = 27/32 (84%), Positives = 29/32 (90%) Frame = -3 Query: 322 DLFWGGGREGEGVNYLGRLLMQLRSEXRSKNL 227 DLFWGGGREGEG+NYLGRLLMQLRSE +NL Sbjct: 582 DLFWGGGREGEGLNYLGRLLMQLRSEILKENL 613 >XP_010268307.1 PREDICTED: riboflavin biosynthesis protein PYRR, chloroplastic isoform X5 [Nelumbo nucifera] Length = 558 Score = 59.7 bits (143), Expect = 7e-08 Identities = 27/36 (75%), Positives = 31/36 (86%) Frame = -3 Query: 331 SSLDLFWGGGREGEGVNYLGRLLMQLRSEXRSKNLS 224 S DLFWGGGREGEG+NYLGRLLMQLRSE ++L+ Sbjct: 494 SPYDLFWGGGREGEGLNYLGRLLMQLRSEFLGESLT 529 >XP_010268306.1 PREDICTED: riboflavin biosynthesis protein PYRR, chloroplastic isoform X4 [Nelumbo nucifera] Length = 563 Score = 59.7 bits (143), Expect = 7e-08 Identities = 27/36 (75%), Positives = 31/36 (86%) Frame = -3 Query: 331 SSLDLFWGGGREGEGVNYLGRLLMQLRSEXRSKNLS 224 S DLFWGGGREGEG+NYLGRLLMQLRSE ++L+ Sbjct: 499 SPYDLFWGGGREGEGLNYLGRLLMQLRSEFLGESLT 534 >XP_010268305.1 PREDICTED: riboflavin biosynthesis protein PYRR, chloroplastic isoform X3 [Nelumbo nucifera] Length = 581 Score = 59.7 bits (143), Expect = 7e-08 Identities = 27/36 (75%), Positives = 31/36 (86%) Frame = -3 Query: 331 SSLDLFWGGGREGEGVNYLGRLLMQLRSEXRSKNLS 224 S DLFWGGGREGEG+NYLGRLLMQLRSE ++L+ Sbjct: 539 SPYDLFWGGGREGEGLNYLGRLLMQLRSEFLGESLT 574 >XP_010268304.1 PREDICTED: riboflavin biosynthesis protein PYRR, chloroplastic isoform X2 [Nelumbo nucifera] Length = 585 Score = 59.7 bits (143), Expect = 7e-08 Identities = 27/36 (75%), Positives = 31/36 (86%) Frame = -3 Query: 331 SSLDLFWGGGREGEGVNYLGRLLMQLRSEXRSKNLS 224 S DLFWGGGREGEG+NYLGRLLMQLRSE ++L+ Sbjct: 539 SPYDLFWGGGREGEGLNYLGRLLMQLRSEFLGESLT 574 >XP_010268302.1 PREDICTED: riboflavin biosynthesis protein PYRR, chloroplastic isoform X1 [Nelumbo nucifera] XP_010268303.1 PREDICTED: riboflavin biosynthesis protein PYRR, chloroplastic isoform X1 [Nelumbo nucifera] Length = 603 Score = 59.7 bits (143), Expect = 7e-08 Identities = 27/36 (75%), Positives = 31/36 (86%) Frame = -3 Query: 331 SSLDLFWGGGREGEGVNYLGRLLMQLRSEXRSKNLS 224 S DLFWGGGREGEG+NYLGRLLMQLRSE ++L+ Sbjct: 539 SPYDLFWGGGREGEGLNYLGRLLMQLRSEFLGESLT 574 >KFK34036.1 hypothetical protein AALP_AA5G093600 [Arabis alpina] Length = 595 Score = 58.9 bits (141), Expect = 1e-07 Identities = 26/31 (83%), Positives = 29/31 (93%) Frame = -3 Query: 322 DLFWGGGREGEGVNYLGRLLMQLRSEXRSKN 230 DLFWGGGREGEG+NYLGRLLMQLR+E SK+ Sbjct: 555 DLFWGGGREGEGLNYLGRLLMQLRAEYLSKS 585 >XP_010907914.1 PREDICTED: riboflavin biosynthesis protein PYRR, chloroplastic isoform X1 [Elaeis guineensis] Length = 596 Score = 58.9 bits (141), Expect = 1e-07 Identities = 26/31 (83%), Positives = 28/31 (90%) Frame = -3 Query: 322 DLFWGGGREGEGVNYLGRLLMQLRSEXRSKN 230 DLFWGGGREGEG+NYLGRLLMQLRSE +N Sbjct: 558 DLFWGGGREGEGLNYLGRLLMQLRSEILKEN 588 >KMZ65220.1 Diaminohydroxyphosphoribosylaminopyrimidine deaminase [Zostera marina] Length = 579 Score = 58.2 bits (139), Expect = 2e-07 Identities = 26/33 (78%), Positives = 30/33 (90%) Frame = -3 Query: 322 DLFWGGGREGEGVNYLGRLLMQLRSEXRSKNLS 224 DLFWGGGR+GEG+NYLGRLLMQLR+E S +LS Sbjct: 543 DLFWGGGRDGEGLNYLGRLLMQLRAELLSGDLS 575 >BAS78634.1 Os02g0473000, partial [Oryza sativa Japonica Group] Length = 250 Score = 57.4 bits (137), Expect = 3e-07 Identities = 25/26 (96%), Positives = 26/26 (100%) Frame = -3 Query: 322 DLFWGGGREGEGVNYLGRLLMQLRSE 245 DLFWGGGREGEG+NYLGRLLMQLRSE Sbjct: 210 DLFWGGGREGEGMNYLGRLLMQLRSE 235 >XP_003631864.1 PREDICTED: riboflavin biosynthesis protein PYRR, chloroplastic isoform X2 [Vitis vinifera] CBI17616.3 unnamed protein product, partial [Vitis vinifera] Length = 586 Score = 57.8 bits (138), Expect = 3e-07 Identities = 25/33 (75%), Positives = 30/33 (90%) Frame = -3 Query: 322 DLFWGGGREGEGVNYLGRLLMQLRSEXRSKNLS 224 DLFWGGGR+GEG+NYLGRLLMQLRSE ++L+ Sbjct: 545 DLFWGGGRDGEGLNYLGRLLMQLRSEFLGESLT 577 >CAN60371.1 hypothetical protein VITISV_041263 [Vitis vinifera] Length = 587 Score = 57.8 bits (138), Expect = 3e-07 Identities = 25/33 (75%), Positives = 30/33 (90%) Frame = -3 Query: 322 DLFWGGGREGEGVNYLGRLLMQLRSEXRSKNLS 224 DLFWGGGR+GEG+NYLGRLLMQLRSE ++L+ Sbjct: 545 DLFWGGGRDGEGLNYLGRLLMQLRSEFLGESLT 577 >OMO50536.1 CMP/dCMP deaminase, zinc-binding protein [Corchorus olitorius] Length = 592 Score = 57.8 bits (138), Expect = 3e-07 Identities = 26/33 (78%), Positives = 29/33 (87%) Frame = -3 Query: 322 DLFWGGGREGEGVNYLGRLLMQLRSEXRSKNLS 224 DLFWGGGREGEG+NYLGRLLMQLRSE ++ S Sbjct: 551 DLFWGGGREGEGLNYLGRLLMQLRSEFLGESSS 583 >OMO77970.1 CMP/dCMP deaminase, zinc-binding protein [Corchorus capsularis] Length = 593 Score = 57.8 bits (138), Expect = 3e-07 Identities = 26/33 (78%), Positives = 29/33 (87%) Frame = -3 Query: 322 DLFWGGGREGEGVNYLGRLLMQLRSEXRSKNLS 224 DLFWGGGREGEG+NYLGRLLMQLRSE ++ S Sbjct: 552 DLFWGGGREGEGLNYLGRLLMQLRSEFLGESSS 584 >XP_019075163.1 PREDICTED: riboflavin biosynthesis protein PYRR, chloroplastic isoform X1 [Vitis vinifera] Length = 597 Score = 57.8 bits (138), Expect = 3e-07 Identities = 25/33 (75%), Positives = 30/33 (90%) Frame = -3 Query: 322 DLFWGGGREGEGVNYLGRLLMQLRSEXRSKNLS 224 DLFWGGGR+GEG+NYLGRLLMQLRSE ++L+ Sbjct: 556 DLFWGGGRDGEGLNYLGRLLMQLRSEFLGESLT 588 >KZV47660.1 riboflavin biosynthesis protein PYRR, chloroplastic-like [Dorcoceras hygrometricum] Length = 599 Score = 57.8 bits (138), Expect = 3e-07 Identities = 25/34 (73%), Positives = 29/34 (85%) Frame = -3 Query: 322 DLFWGGGREGEGVNYLGRLLMQLRSEXRSKNLSP 221 DLFWGGGR+GEG+NYLGRLLMQLRSE + + P Sbjct: 557 DLFWGGGRDGEGLNYLGRLLMQLRSEFLADSYEP 590 >XP_011077162.1 PREDICTED: riboflavin biosynthesis protein PYRR, chloroplastic [Sesamum indicum] Length = 607 Score = 57.8 bits (138), Expect = 3e-07 Identities = 26/29 (89%), Positives = 27/29 (93%) Frame = -3 Query: 322 DLFWGGGREGEGVNYLGRLLMQLRSEXRS 236 DLFWGGGREGEG+NYLGRLLMQLRSE S Sbjct: 557 DLFWGGGREGEGLNYLGRLLMQLRSEFLS 585 >XP_006428600.1 hypothetical protein CICLE_v10011346mg [Citrus clementina] XP_006428601.1 hypothetical protein CICLE_v10011346mg [Citrus clementina] XP_006428605.1 hypothetical protein CICLE_v10011346mg [Citrus clementina] ESR41840.1 hypothetical protein CICLE_v10011346mg [Citrus clementina] ESR41841.1 hypothetical protein CICLE_v10011346mg [Citrus clementina] ESR41845.1 hypothetical protein CICLE_v10011346mg [Citrus clementina] Length = 395 Score = 57.4 bits (137), Expect = 4e-07 Identities = 25/26 (96%), Positives = 26/26 (100%) Frame = -3 Query: 322 DLFWGGGREGEGVNYLGRLLMQLRSE 245 DLFWGGGREGEG+NYLGRLLMQLRSE Sbjct: 361 DLFWGGGREGEGLNYLGRLLMQLRSE 386 >XP_015688811.1 PREDICTED: riboflavin biosynthesis protein PYRR, chloroplastic isoform X2 [Oryza brachyantha] Length = 401 Score = 57.4 bits (137), Expect = 4e-07 Identities = 25/26 (96%), Positives = 26/26 (100%) Frame = -3 Query: 322 DLFWGGGREGEGVNYLGRLLMQLRSE 245 DLFWGGGREGEG+NYLGRLLMQLRSE Sbjct: 361 DLFWGGGREGEGMNYLGRLLMQLRSE 386 >BAG89528.1 unnamed protein product [Oryza sativa Japonica Group] Length = 401 Score = 57.4 bits (137), Expect = 4e-07 Identities = 25/26 (96%), Positives = 26/26 (100%) Frame = -3 Query: 322 DLFWGGGREGEGVNYLGRLLMQLRSE 245 DLFWGGGREGEG+NYLGRLLMQLRSE Sbjct: 361 DLFWGGGREGEGMNYLGRLLMQLRSE 386