BLASTX nr result
ID: Angelica27_contig00027885
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00027885 (391 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017242624.1 PREDICTED: CCR4-NOT transcription complex subunit... 62 9e-09 KZN00569.1 hypothetical protein DCAR_009323 [Daucus carota subsp... 62 9e-09 >XP_017242624.1 PREDICTED: CCR4-NOT transcription complex subunit 10-like [Daucus carota subsp. sativus] Length = 840 Score = 62.4 bits (150), Expect = 9e-09 Identities = 29/34 (85%), Positives = 31/34 (91%) Frame = -1 Query: 391 LDLMSGKSHEAITRLKNCSHVTFLPGSFAVTGSS 290 LDLM GKS EAI+RLKNCSH+TFLPGSFAVTG S Sbjct: 807 LDLMLGKSREAISRLKNCSHITFLPGSFAVTGPS 840 >KZN00569.1 hypothetical protein DCAR_009323 [Daucus carota subsp. sativus] Length = 877 Score = 62.4 bits (150), Expect = 9e-09 Identities = 29/34 (85%), Positives = 31/34 (91%) Frame = -1 Query: 391 LDLMSGKSHEAITRLKNCSHVTFLPGSFAVTGSS 290 LDLM GKS EAI+RLKNCSH+TFLPGSFAVTG S Sbjct: 844 LDLMLGKSREAISRLKNCSHITFLPGSFAVTGPS 877