BLASTX nr result
ID: Angelica27_contig00027801
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00027801 (223 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KZM92662.1 hypothetical protein DCAR_019973 [Daucus carota subsp... 86 4e-20 KZN00851.1 hypothetical protein DCAR_009605 [Daucus carota subsp... 77 8e-17 XP_019414597.1 PREDICTED: auxin-induced protein 6B-like [Lupinus... 74 1e-15 XP_002300214.1 hypothetical protein POPTR_0001s31380g [Populus t... 72 9e-15 NP_001236702.1 uncharacterized protein LOC100306557 [Glycine max... 72 1e-14 CDP04616.1 unnamed protein product [Coffea canephora] 71 2e-14 OIV97035.1 hypothetical protein TanjilG_19582 [Lupinus angustifo... 71 2e-14 XP_003532148.1 PREDICTED: auxin-responsive protein SAUR32-like [... 71 3e-14 XP_007137736.1 hypothetical protein PHAVU_009G151600g [Phaseolus... 71 3e-14 KZM92664.1 hypothetical protein DCAR_019971 [Daucus carota subsp... 70 3e-14 AFK42432.1 unknown [Lotus japonicus] AFK45903.1 unknown [Lotus j... 70 3e-14 XP_018808507.1 PREDICTED: auxin-induced protein 6B-like [Juglans... 70 3e-14 GAU19535.1 hypothetical protein TSUD_303480 [Trifolium subterran... 70 4e-14 XP_010272893.1 PREDICTED: auxin-induced protein 6B-like [Nelumbo... 70 4e-14 XP_016169280.1 PREDICTED: auxin-induced protein 6B-like [Arachis... 70 5e-14 OIT03335.1 auxin-responsive protein saur32 [Nicotiana attenuata] 70 5e-14 XP_010025710.2 PREDICTED: auxin-induced protein 6B-like [Eucalyp... 70 5e-14 XP_017614837.1 PREDICTED: auxin-responsive protein SAUR32-like [... 70 5e-14 KOM30538.1 hypothetical protein LR48_Vigan01g009200 [Vigna angul... 70 5e-14 XP_014508049.1 PREDICTED: auxin-induced protein 6B-like [Vigna r... 70 7e-14 >KZM92662.1 hypothetical protein DCAR_019973 [Daucus carota subsp. sativus] Length = 97 Score = 85.5 bits (210), Expect = 4e-20 Identities = 37/41 (90%), Positives = 39/41 (95%) Frame = -3 Query: 221 AHEVYGYHISGPLKLPCSVDEFVHLRWQIEKESGNHRRQRH 99 AHEVYGYH+SGPLKLPCSVDEFVHLRWQIEKESG+ RR RH Sbjct: 42 AHEVYGYHVSGPLKLPCSVDEFVHLRWQIEKESGSFRRLRH 82 Score = 55.5 bits (132), Expect = 2e-08 Identities = 29/32 (90%), Positives = 29/32 (90%) Frame = -1 Query: 97 VQVGLEEEQEVPSRFVIPISYLYNPLFRQLLD 2 VQVGLEEE E SRFVIPISYLYNPLFRQLLD Sbjct: 10 VQVGLEEELEA-SRFVIPISYLYNPLFRQLLD 40 >KZN00851.1 hypothetical protein DCAR_009605 [Daucus carota subsp. sativus] Length = 100 Score = 77.0 bits (188), Expect = 8e-17 Identities = 32/41 (78%), Positives = 36/41 (87%) Frame = -3 Query: 221 AHEVYGYHISGPLKLPCSVDEFVHLRWQIEKESGNHRRQRH 99 AHEVYGYHISGPLKLPCSVDEF+HLRW+IEKE + R+ H Sbjct: 47 AHEVYGYHISGPLKLPCSVDEFIHLRWRIEKEGNKNYRKHH 87 Score = 55.8 bits (133), Expect = 2e-08 Identities = 25/32 (78%), Positives = 30/32 (93%) Frame = -1 Query: 97 VQVGLEEEQEVPSRFVIPISYLYNPLFRQLLD 2 VQVGLEEE E P++FVIPISYLY+P+F+QLLD Sbjct: 14 VQVGLEEENERPTKFVIPISYLYSPIFQQLLD 45 >XP_019414597.1 PREDICTED: auxin-induced protein 6B-like [Lupinus angustifolius] OIV98116.1 hypothetical protein TanjilG_25981 [Lupinus angustifolius] Length = 106 Score = 74.3 bits (181), Expect = 1e-15 Identities = 30/41 (73%), Positives = 36/41 (87%) Frame = -3 Query: 221 AHEVYGYHISGPLKLPCSVDEFVHLRWQIEKESGNHRRQRH 99 A+EVYGYH GPLKLPCSVD+F+HLRW+IEKESG++R H Sbjct: 54 AYEVYGYHTDGPLKLPCSVDDFLHLRWRIEKESGHYRHNHH 94 >XP_002300214.1 hypothetical protein POPTR_0001s31380g [Populus trichocarpa] EEE85019.1 hypothetical protein POPTR_0001s31380g [Populus trichocarpa] Length = 106 Score = 72.0 bits (175), Expect = 9e-15 Identities = 28/41 (68%), Positives = 35/41 (85%) Frame = -3 Query: 221 AHEVYGYHISGPLKLPCSVDEFVHLRWQIEKESGNHRRQRH 99 AHEVYGYH +GPL++PCSVD+F+HLRW+IEKES +H H Sbjct: 52 AHEVYGYHTTGPLRVPCSVDDFLHLRWRIEKESSHHSHHSH 92 >NP_001236702.1 uncharacterized protein LOC100306557 [Glycine max] ACU14780.1 unknown [Glycine max] KHN17415.1 Auxin-induced protein 6B [Glycine soja] KRH59646.1 hypothetical protein GLYMA_05G196300 [Glycine max] Length = 101 Score = 71.6 bits (174), Expect = 1e-14 Identities = 29/41 (70%), Positives = 34/41 (82%) Frame = -3 Query: 221 AHEVYGYHISGPLKLPCSVDEFVHLRWQIEKESGNHRRQRH 99 A+EVYGYH GPLKLPCSVD+F+HLRW+IEKES H +H Sbjct: 43 AYEVYGYHTEGPLKLPCSVDDFLHLRWRIEKESTTHHHHQH 83 >CDP04616.1 unnamed protein product [Coffea canephora] Length = 102 Score = 71.2 bits (173), Expect = 2e-14 Identities = 28/41 (68%), Positives = 35/41 (85%) Frame = -3 Query: 221 AHEVYGYHISGPLKLPCSVDEFVHLRWQIEKESGNHRRQRH 99 AHEVYGYH +GPL+LPCSVD+F+HLRW+IEKE+ N+ H Sbjct: 44 AHEVYGYHATGPLRLPCSVDDFLHLRWRIEKETNNYHNHFH 84 >OIV97035.1 hypothetical protein TanjilG_19582 [Lupinus angustifolius] Length = 100 Score = 70.9 bits (172), Expect = 2e-14 Identities = 28/37 (75%), Positives = 35/37 (94%) Frame = -3 Query: 221 AHEVYGYHISGPLKLPCSVDEFVHLRWQIEKESGNHR 111 A+EVYGYH +GPLKLPCS+DEF+HLRW+IEKE G+H+ Sbjct: 47 AYEVYGYHTNGPLKLPCSIDEFLHLRWRIEKEYGHHQ 83 >XP_003532148.1 PREDICTED: auxin-responsive protein SAUR32-like [Glycine max] KHN16921.1 Auxin-induced protein 6B [Glycine soja] KRH40994.1 hypothetical protein GLYMA_08G004100 [Glycine max] Length = 105 Score = 70.9 bits (172), Expect = 3e-14 Identities = 28/41 (68%), Positives = 33/41 (80%) Frame = -3 Query: 221 AHEVYGYHISGPLKLPCSVDEFVHLRWQIEKESGNHRRQRH 99 A+EVYGYH GPLKLPCSVD+F+HLRW+I+KES H H Sbjct: 46 AYEVYGYHTEGPLKLPCSVDDFLHLRWRIQKESSTHHHHNH 86 >XP_007137736.1 hypothetical protein PHAVU_009G151600g [Phaseolus vulgaris] ESW09730.1 hypothetical protein PHAVU_009G151600g [Phaseolus vulgaris] Length = 107 Score = 70.9 bits (172), Expect = 3e-14 Identities = 29/37 (78%), Positives = 33/37 (89%) Frame = -3 Query: 221 AHEVYGYHISGPLKLPCSVDEFVHLRWQIEKESGNHR 111 AHEVYGYH GPLKLPCSVD+F+HLRW IEKES +H+ Sbjct: 52 AHEVYGYHTDGPLKLPCSVDDFLHLRWLIEKESSSHQ 88 >KZM92664.1 hypothetical protein DCAR_019971 [Daucus carota subsp. sativus] Length = 80 Score = 70.1 bits (170), Expect = 3e-14 Identities = 29/32 (90%), Positives = 32/32 (100%) Frame = -3 Query: 221 AHEVYGYHISGPLKLPCSVDEFVHLRWQIEKE 126 AHEVYGYHISGPL+LPCSVDEFVHLRWQIE++ Sbjct: 47 AHEVYGYHISGPLRLPCSVDEFVHLRWQIERK 78 Score = 50.8 bits (120), Expect = 1e-06 Identities = 24/32 (75%), Positives = 27/32 (84%) Frame = -1 Query: 97 VQVGLEEEQEVPSRFVIPISYLYNPLFRQLLD 2 VQVGLE+E E+ SRF IPI YL NPLFR+LLD Sbjct: 14 VQVGLEDEDEIASRFHIPIFYLNNPLFRELLD 45 >AFK42432.1 unknown [Lotus japonicus] AFK45903.1 unknown [Lotus japonicus] Length = 97 Score = 70.5 bits (171), Expect = 3e-14 Identities = 29/41 (70%), Positives = 32/41 (78%) Frame = -3 Query: 221 AHEVYGYHISGPLKLPCSVDEFVHLRWQIEKESGNHRRQRH 99 A EVYGYH GPLKLPCS+D+F+HLRWQIEKES N H Sbjct: 44 AREVYGYHTEGPLKLPCSLDDFLHLRWQIEKESSNSHHNNH 84 >XP_018808507.1 PREDICTED: auxin-induced protein 6B-like [Juglans regia] Length = 103 Score = 70.5 bits (171), Expect = 3e-14 Identities = 29/48 (60%), Positives = 36/48 (75%) Frame = -3 Query: 221 AHEVYGYHISGPLKLPCSVDEFVHLRWQIEKESGNHRRQRHGPSWIRG 78 AHEVYGYH +GPL+LPCSVD+F+HLRW+IEKE +H S + G Sbjct: 49 AHEVYGYHTTGPLRLPCSVDDFLHLRWRIEKEPNHHHHHHQHHSHLPG 96 >GAU19535.1 hypothetical protein TSUD_303480 [Trifolium subterraneum] Length = 108 Score = 70.5 bits (171), Expect = 4e-14 Identities = 30/45 (66%), Positives = 37/45 (82%), Gaps = 4/45 (8%) Frame = -3 Query: 221 AHEVYGYHISGPLKLPCSVDEFVHLRWQIEKESG----NHRRQRH 99 A++VYGYH +GPLKLPCSVD+F+HLRW+IEKESG NH +H Sbjct: 53 AYDVYGYHTNGPLKLPCSVDDFLHLRWRIEKESGPNQHNHNHHQH 97 >XP_010272893.1 PREDICTED: auxin-induced protein 6B-like [Nelumbo nucifera] Length = 113 Score = 70.5 bits (171), Expect = 4e-14 Identities = 28/45 (62%), Positives = 36/45 (80%) Frame = -3 Query: 221 AHEVYGYHISGPLKLPCSVDEFVHLRWQIEKESGNHRRQRHGPSW 87 A EVYGYH +GPL+LPCSVD+F+HLRW+IE+ES +H H S+ Sbjct: 64 AQEVYGYHSTGPLRLPCSVDDFLHLRWRIERESNSHHHHSHSSSF 108 >XP_016169280.1 PREDICTED: auxin-induced protein 6B-like [Arachis ipaensis] Length = 117 Score = 70.5 bits (171), Expect = 5e-14 Identities = 29/41 (70%), Positives = 34/41 (82%) Frame = -3 Query: 221 AHEVYGYHISGPLKLPCSVDEFVHLRWQIEKESGNHRRQRH 99 A+EVYGYH GPLKLPCSVD+F+HLRW+IEKES +H H Sbjct: 54 AYEVYGYHTDGPLKLPCSVDDFLHLRWRIEKESNHHGAASH 94 Score = 50.8 bits (120), Expect = 2e-06 Identities = 25/35 (71%), Positives = 29/35 (82%), Gaps = 3/35 (8%) Frame = -1 Query: 97 VQVGLEEEQE---VPSRFVIPISYLYNPLFRQLLD 2 VQVGLE+E E P RFVIPISYLY+PLF++LLD Sbjct: 18 VQVGLEDESEEGSTPQRFVIPISYLYHPLFKRLLD 52 >OIT03335.1 auxin-responsive protein saur32 [Nicotiana attenuata] Length = 103 Score = 70.1 bits (170), Expect = 5e-14 Identities = 28/45 (62%), Positives = 33/45 (73%) Frame = -3 Query: 221 AHEVYGYHISGPLKLPCSVDEFVHLRWQIEKESGNHRRQRHGPSW 87 AH+VYGYH GPLKLPCSVD+F+H+RWQIEKE H P + Sbjct: 43 AHDVYGYHAVGPLKLPCSVDDFLHIRWQIEKEPNRSHHHHHHPHY 87 >XP_010025710.2 PREDICTED: auxin-induced protein 6B-like [Eucalyptus grandis] Length = 103 Score = 70.1 bits (170), Expect = 5e-14 Identities = 29/42 (69%), Positives = 35/42 (83%), Gaps = 1/42 (2%) Frame = -3 Query: 221 AHEVYGYHISGPLKLPCSVDEFVHLRWQIEKE-SGNHRRQRH 99 AHE YGYH +GPL+LPCSVD+F+HLRW+IEKE SG+H H Sbjct: 43 AHEAYGYHANGPLRLPCSVDDFLHLRWRIEKESSGSHHHHNH 84 Score = 50.1 bits (118), Expect = 4e-06 Identities = 24/32 (75%), Positives = 27/32 (84%) Frame = -1 Query: 97 VQVGLEEEQEVPSRFVIPISYLYNPLFRQLLD 2 VQVGLEEE RFVIPISYLY+PLF++LLD Sbjct: 10 VQVGLEEEDGGVERFVIPISYLYHPLFKRLLD 41 >XP_017614837.1 PREDICTED: auxin-responsive protein SAUR32-like [Gossypium arboreum] Length = 103 Score = 70.1 bits (170), Expect = 5e-14 Identities = 28/41 (68%), Positives = 34/41 (82%) Frame = -3 Query: 221 AHEVYGYHISGPLKLPCSVDEFVHLRWQIEKESGNHRRQRH 99 A+EVYGYH GPLKLPCSVD+F++L+WQIEKES +H H Sbjct: 50 AYEVYGYHTKGPLKLPCSVDDFLNLKWQIEKESNHHHHHHH 90 >KOM30538.1 hypothetical protein LR48_Vigan01g009200 [Vigna angularis] KOM30539.1 hypothetical protein LR48_Vigan01g009300 [Vigna angularis] BAT73214.1 hypothetical protein VIGAN_01068100 [Vigna angularis var. angularis] Length = 105 Score = 70.1 bits (170), Expect = 5e-14 Identities = 28/41 (68%), Positives = 33/41 (80%) Frame = -3 Query: 221 AHEVYGYHISGPLKLPCSVDEFVHLRWQIEKESGNHRRQRH 99 A+EVYGYH GPLKLPCSVD+F+HLRW+I KE+ H R H Sbjct: 46 AYEVYGYHTQGPLKLPCSVDDFLHLRWRIHKEATTHHRHNH 86 >XP_014508049.1 PREDICTED: auxin-induced protein 6B-like [Vigna radiata var. radiata] Length = 115 Score = 70.1 bits (170), Expect = 7e-14 Identities = 28/41 (68%), Positives = 33/41 (80%) Frame = -3 Query: 221 AHEVYGYHISGPLKLPCSVDEFVHLRWQIEKESGNHRRQRH 99 A+EVYGYH GPLKLPCSVD+F+HLRW+I KE+ H R H Sbjct: 57 AYEVYGYHTQGPLKLPCSVDDFLHLRWRIHKEATTHHRHNH 97