BLASTX nr result
ID: Angelica27_contig00027726
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00027726 (930 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value EPS74167.1 hypothetical protein M569_00588, partial [Genlisea au... 90 3e-19 KQK20681.1 hypothetical protein BRADI_1g63372 [Brachypodium dist... 81 4e-16 KXG18792.1 hypothetical protein SORBI_K033500 [Sorghum bicolor] 64 4e-10 OEL35491.1 hypothetical protein BAE44_0003490 [Dichanthelium oli... 58 7e-08 >EPS74167.1 hypothetical protein M569_00588, partial [Genlisea aurea] Length = 72 Score = 89.7 bits (221), Expect = 3e-19 Identities = 40/45 (88%), Positives = 43/45 (95%) Frame = -2 Query: 923 RVAGIEPASLAWKARGYSRRRFSIFNVSNSKPNMKLWFHSAPLWK 789 RVAGIEPASLAWKA+GYSRRRFS +VSNSKPNMKLWFHSAPLW+ Sbjct: 13 RVAGIEPASLAWKAKGYSRRRFSSLSVSNSKPNMKLWFHSAPLWR 57 >KQK20681.1 hypothetical protein BRADI_1g63372 [Brachypodium distachyon] Length = 59 Score = 80.9 bits (198), Expect = 4e-16 Identities = 38/44 (86%), Positives = 39/44 (88%) Frame = -2 Query: 923 RVAGIEPASLAWKARGYSRRRFSIFNVSNSKPNMKLWFHSAPLW 792 RVAGIEPASLAWKARGYSRR I+NVSNSKPNMK FHSAPLW Sbjct: 3 RVAGIEPASLAWKARGYSRRWLIIYNVSNSKPNMKFSFHSAPLW 46 >KXG18792.1 hypothetical protein SORBI_K033500 [Sorghum bicolor] Length = 51 Score = 64.3 bits (155), Expect = 4e-10 Identities = 31/35 (88%), Positives = 32/35 (91%) Frame = -2 Query: 923 RVAGIEPASLAWKARGYSRRRFSIFNVSNSKPNMK 819 RVAGIEPASLAWKARGYSRR IF+VSNSKPNMK Sbjct: 16 RVAGIEPASLAWKARGYSRRWLIIFDVSNSKPNMK 50 >OEL35491.1 hypothetical protein BAE44_0003490 [Dichanthelium oligosanthes] Length = 51 Score = 58.2 bits (139), Expect = 7e-08 Identities = 28/35 (80%), Positives = 28/35 (80%) Frame = -2 Query: 923 RVAGIEPASLAWKARGYSRRRFSIFNVSNSKPNMK 819 RV GIEP LAWKARGYS R IFNVSNSKPNMK Sbjct: 16 RVVGIEPTLLAWKARGYSGRWLIIFNVSNSKPNMK 50