BLASTX nr result
ID: Angelica27_contig00027596
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00027596 (362 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KNA06117.1 hypothetical protein SOVF_184030 [Spinacia oleracea] 65 3e-11 ADM74131.1 glutathione peroxidase-like protein, partial [Picea s... 64 8e-11 ADM74114.1 glutathione peroxidase-like protein, partial [Picea s... 64 8e-11 ADM74105.1 glutathione peroxidase-like protein, partial [Picea s... 64 8e-11 ADM74101.1 glutathione peroxidase-like protein, partial [Picea s... 64 8e-11 ADM74094.1 glutathione peroxidase-like protein, partial [Picea s... 64 8e-11 ADM74090.1 glutathione peroxidase-like protein, partial [Picea s... 64 8e-11 ADM74088.1 glutathione peroxidase-like protein, partial [Picea s... 64 8e-11 ADM74087.1 glutathione peroxidase-like protein, partial [Picea s... 64 8e-11 O23814.1 RecName: Full=Probable phospholipid hydroperoxide gluta... 65 1e-10 ABQ96600.1 glutathione peroxidase, partial [Salvinia cucullata] 63 1e-10 XP_010695174.2 PREDICTED: probable phospholipid hydroperoxide gl... 65 1e-10 ABK23478.1 unknown [Picea sitchensis] 65 1e-10 AGT98543.1 glutathione peroxidase 2 [Pinus tabuliformis] 64 4e-10 ABK21107.1 unknown [Picea sitchensis] ABK26068.1 unknown [Picea ... 64 4e-10 ADM74103.1 glutathione peroxidase-like protein, partial [Picea s... 62 5e-10 ADM74091.1 glutathione peroxidase-like protein, partial [Picea s... 62 5e-10 WP_071414500.1 glutathione peroxidase [Acinetobacter baumannii] ... 63 6e-10 AGT98542.1 glutathione peroxidase 1 [Pinus tabuliformis] 63 8e-10 ACN41122.1 unknown [Picea sitchensis] 62 1e-09 >KNA06117.1 hypothetical protein SOVF_184030 [Spinacia oleracea] Length = 118 Score = 65.1 bits (157), Expect = 3e-11 Identities = 29/34 (85%), Positives = 33/34 (97%) Frame = +2 Query: 2 TKFLVDKEGNVVERYAPTTSPKSIEKDIKKYLGV 103 TKFLVDK+GNVV+RYAPTTSPKSIEKD+KK LG+ Sbjct: 83 TKFLVDKDGNVVDRYAPTTSPKSIEKDVKKLLGI 116 >ADM74131.1 glutathione peroxidase-like protein, partial [Picea sitchensis] Length = 98 Score = 63.5 bits (153), Expect = 8e-11 Identities = 29/34 (85%), Positives = 32/34 (94%) Frame = +2 Query: 2 TKFLVDKEGNVVERYAPTTSPKSIEKDIKKYLGV 103 TKFLVDK+GNVVERYAPTTSP SIEKD+KK LG+ Sbjct: 64 TKFLVDKDGNVVERYAPTTSPLSIEKDVKKLLGI 97 >ADM74114.1 glutathione peroxidase-like protein, partial [Picea sitchensis] Length = 98 Score = 63.5 bits (153), Expect = 8e-11 Identities = 29/34 (85%), Positives = 32/34 (94%) Frame = +2 Query: 2 TKFLVDKEGNVVERYAPTTSPKSIEKDIKKYLGV 103 TKFLVDK+GNVVERYAPTTSP SIEKD+KK LG+ Sbjct: 64 TKFLVDKDGNVVERYAPTTSPLSIEKDVKKLLGI 97 >ADM74105.1 glutathione peroxidase-like protein, partial [Picea sitchensis] Length = 98 Score = 63.5 bits (153), Expect = 8e-11 Identities = 29/34 (85%), Positives = 32/34 (94%) Frame = +2 Query: 2 TKFLVDKEGNVVERYAPTTSPKSIEKDIKKYLGV 103 TKFLVDK+GNVVERYAPTTSP SIEKD+KK LG+ Sbjct: 64 TKFLVDKDGNVVERYAPTTSPLSIEKDVKKLLGI 97 >ADM74101.1 glutathione peroxidase-like protein, partial [Picea sitchensis] Length = 98 Score = 63.5 bits (153), Expect = 8e-11 Identities = 29/34 (85%), Positives = 32/34 (94%) Frame = +2 Query: 2 TKFLVDKEGNVVERYAPTTSPKSIEKDIKKYLGV 103 TKFLVDK+GNVVERYAPTTSP SIEKD+KK LG+ Sbjct: 64 TKFLVDKDGNVVERYAPTTSPLSIEKDVKKLLGI 97 >ADM74094.1 glutathione peroxidase-like protein, partial [Picea sitchensis] ADM74096.1 glutathione peroxidase-like protein, partial [Picea sitchensis] Length = 98 Score = 63.5 bits (153), Expect = 8e-11 Identities = 29/34 (85%), Positives = 32/34 (94%) Frame = +2 Query: 2 TKFLVDKEGNVVERYAPTTSPKSIEKDIKKYLGV 103 TKFLVDK+GNVVERYAPTTSP SIEKD+KK LG+ Sbjct: 64 TKFLVDKDGNVVERYAPTTSPLSIEKDVKKLLGI 97 >ADM74090.1 glutathione peroxidase-like protein, partial [Picea sitchensis] ADM74109.1 glutathione peroxidase-like protein, partial [Picea sitchensis] Length = 98 Score = 63.5 bits (153), Expect = 8e-11 Identities = 29/34 (85%), Positives = 32/34 (94%) Frame = +2 Query: 2 TKFLVDKEGNVVERYAPTTSPKSIEKDIKKYLGV 103 TKFLVDK+GNVVERYAPTTSP SIEKD+KK LG+ Sbjct: 64 TKFLVDKDGNVVERYAPTTSPLSIEKDVKKLLGI 97 >ADM74088.1 glutathione peroxidase-like protein, partial [Picea sitchensis] ADM74097.1 glutathione peroxidase-like protein, partial [Picea sitchensis] ADM74099.1 glutathione peroxidase-like protein, partial [Picea sitchensis] Length = 98 Score = 63.5 bits (153), Expect = 8e-11 Identities = 29/34 (85%), Positives = 32/34 (94%) Frame = +2 Query: 2 TKFLVDKEGNVVERYAPTTSPKSIEKDIKKYLGV 103 TKFLVDK+GNVVERYAPTTSP SIEKD+KK LG+ Sbjct: 64 TKFLVDKDGNVVERYAPTTSPLSIEKDVKKLLGI 97 >ADM74087.1 glutathione peroxidase-like protein, partial [Picea sitchensis] ADM74089.1 glutathione peroxidase-like protein, partial [Picea sitchensis] ADM74092.1 glutathione peroxidase-like protein, partial [Picea sitchensis] ADM74093.1 glutathione peroxidase-like protein, partial [Picea sitchensis] ADM74095.1 glutathione peroxidase-like protein, partial [Picea sitchensis] ADM74098.1 glutathione peroxidase-like protein, partial [Picea sitchensis] ADM74100.1 glutathione peroxidase-like protein, partial [Picea sitchensis] ADM74102.1 glutathione peroxidase-like protein, partial [Picea sitchensis] ADM74104.1 glutathione peroxidase-like protein, partial [Picea sitchensis] ADM74106.1 glutathione peroxidase-like protein, partial [Picea sitchensis] ADM74107.1 glutathione peroxidase-like protein, partial [Picea sitchensis] ADM74108.1 glutathione peroxidase-like protein, partial [Picea sitchensis] ADM74110.1 glutathione peroxidase-like protein, partial [Picea sitchensis] ADM74111.1 glutathione peroxidase-like protein, partial [Picea sitchensis] ADM74112.1 glutathione peroxidase-like protein, partial [Picea sitchensis] ADM74113.1 glutathione peroxidase-like protein, partial [Picea sitchensis] ADM74115.1 glutathione peroxidase-like protein, partial [Picea sitchensis] ADM74116.1 glutathione peroxidase-like protein, partial [Picea sitchensis] ADM74117.1 glutathione peroxidase-like protein, partial [Picea sitchensis] ADM74118.1 glutathione peroxidase-like protein, partial [Picea sitchensis] ADM74119.1 glutathione peroxidase-like protein, partial [Picea sitchensis] ADM74120.1 glutathione peroxidase-like protein, partial [Picea sitchensis] ADM74121.1 glutathione peroxidase-like protein, partial [Picea sitchensis] ADM74122.1 glutathione peroxidase-like protein, partial [Picea sitchensis] ADM74123.1 glutathione peroxidase-like protein, partial [Picea sitchensis] ADM74124.1 glutathione peroxidase-like protein, partial [Picea sitchensis] ADM74125.1 glutathione peroxidase-like protein, partial [Picea sitchensis] ADM74126.1 glutathione peroxidase-like protein, partial [Picea sitchensis] ADM74127.1 glutathione peroxidase-like protein, partial [Picea sitchensis] ADM74128.1 glutathione peroxidase-like protein, partial [Picea sitchensis] ADM74129.1 glutathione peroxidase-like protein, partial [Picea sitchensis] ADM74130.1 glutathione peroxidase-like protein, partial [Picea sitchensis] ADM74132.1 glutathione peroxidase-like protein, partial [Picea sitchensis] ADM74133.1 glutathione peroxidase-like protein, partial [Picea sitchensis] ADM74134.1 glutathione peroxidase-like protein, partial [Picea sitchensis] Length = 98 Score = 63.5 bits (153), Expect = 8e-11 Identities = 29/34 (85%), Positives = 32/34 (94%) Frame = +2 Query: 2 TKFLVDKEGNVVERYAPTTSPKSIEKDIKKYLGV 103 TKFLVDK+GNVVERYAPTTSP SIEKD+KK LG+ Sbjct: 64 TKFLVDKDGNVVERYAPTTSPLSIEKDVKKLLGI 97 >O23814.1 RecName: Full=Probable phospholipid hydroperoxide glutathione peroxidase; Short=PHGPx BAA22194.1 phopholipid hydroperoxide glutathione peroxidase-like protein [Spinacia oleracea] Length = 171 Score = 65.1 bits (157), Expect = 1e-10 Identities = 29/34 (85%), Positives = 33/34 (97%) Frame = +2 Query: 2 TKFLVDKEGNVVERYAPTTSPKSIEKDIKKYLGV 103 TKFLVDK+GNVV+RYAPTTSPKSIEKD+KK LG+ Sbjct: 136 TKFLVDKDGNVVDRYAPTTSPKSIEKDVKKLLGI 169 >ABQ96600.1 glutathione peroxidase, partial [Salvinia cucullata] Length = 88 Score = 62.8 bits (151), Expect = 1e-10 Identities = 29/34 (85%), Positives = 32/34 (94%) Frame = +2 Query: 2 TKFLVDKEGNVVERYAPTTSPKSIEKDIKKYLGV 103 TKFLVDK+GNVV+RYAPTTSP SIEKD+KK LGV Sbjct: 54 TKFLVDKDGNVVDRYAPTTSPLSIEKDVKKLLGV 87 >XP_010695174.2 PREDICTED: probable phospholipid hydroperoxide glutathione peroxidase [Beta vulgaris subsp. vulgaris] KMS97897.1 hypothetical protein BVRB_5g123260 [Beta vulgaris subsp. vulgaris] Length = 170 Score = 64.7 bits (156), Expect = 1e-10 Identities = 30/34 (88%), Positives = 32/34 (94%) Frame = +2 Query: 2 TKFLVDKEGNVVERYAPTTSPKSIEKDIKKYLGV 103 TKFLVDKEGNVV+RYAPTTSP SIEKDIKK LG+ Sbjct: 136 TKFLVDKEGNVVDRYAPTTSPSSIEKDIKKLLGI 169 >ABK23478.1 unknown [Picea sitchensis] Length = 170 Score = 64.7 bits (156), Expect = 1e-10 Identities = 30/34 (88%), Positives = 32/34 (94%) Frame = +2 Query: 2 TKFLVDKEGNVVERYAPTTSPKSIEKDIKKYLGV 103 TKFLVDK+GNVVERYAPTTSP SIEKDIKK LG+ Sbjct: 136 TKFLVDKDGNVVERYAPTTSPSSIEKDIKKLLGI 169 >AGT98543.1 glutathione peroxidase 2 [Pinus tabuliformis] Length = 170 Score = 63.5 bits (153), Expect = 4e-10 Identities = 29/34 (85%), Positives = 32/34 (94%) Frame = +2 Query: 2 TKFLVDKEGNVVERYAPTTSPKSIEKDIKKYLGV 103 TKFLVDK+GNVVERYAPTTSP SIEKD+KK LG+ Sbjct: 136 TKFLVDKDGNVVERYAPTTSPLSIEKDVKKLLGI 169 >ABK21107.1 unknown [Picea sitchensis] ABK26068.1 unknown [Picea sitchensis] ABR17146.1 unknown [Picea sitchensis] ABR17155.1 unknown [Picea sitchensis] Length = 170 Score = 63.5 bits (153), Expect = 4e-10 Identities = 29/34 (85%), Positives = 32/34 (94%) Frame = +2 Query: 2 TKFLVDKEGNVVERYAPTTSPKSIEKDIKKYLGV 103 TKFLVDK+GNVVERYAPTTSP SIEKD+KK LG+ Sbjct: 136 TKFLVDKDGNVVERYAPTTSPLSIEKDVKKLLGI 169 >ADM74103.1 glutathione peroxidase-like protein, partial [Picea sitchensis] Length = 98 Score = 61.6 bits (148), Expect = 5e-10 Identities = 28/34 (82%), Positives = 32/34 (94%) Frame = +2 Query: 2 TKFLVDKEGNVVERYAPTTSPKSIEKDIKKYLGV 103 TKFLVDK+GNVVERYAPTTSP SIEK++KK LG+ Sbjct: 64 TKFLVDKDGNVVERYAPTTSPLSIEKNVKKLLGI 97 >ADM74091.1 glutathione peroxidase-like protein, partial [Picea sitchensis] Length = 98 Score = 61.6 bits (148), Expect = 5e-10 Identities = 28/34 (82%), Positives = 32/34 (94%) Frame = +2 Query: 2 TKFLVDKEGNVVERYAPTTSPKSIEKDIKKYLGV 103 TKFLVDK+GNVVERYAPTTSP SIEK++KK LG+ Sbjct: 64 TKFLVDKDGNVVERYAPTTSPLSIEKNVKKLLGI 97 >WP_071414500.1 glutathione peroxidase [Acinetobacter baumannii] OIC58742.1 glutathione peroxidase [Acinetobacter baumannii] Length = 170 Score = 63.2 bits (152), Expect = 6e-10 Identities = 29/34 (85%), Positives = 32/34 (94%) Frame = +2 Query: 2 TKFLVDKEGNVVERYAPTTSPKSIEKDIKKYLGV 103 TKFLVDK+GNVVERYAPTTSP SIEKD+KK LG+ Sbjct: 136 TKFLVDKDGNVVERYAPTTSPLSIEKDVKKRLGI 169 >AGT98542.1 glutathione peroxidase 1 [Pinus tabuliformis] Length = 170 Score = 62.8 bits (151), Expect = 8e-10 Identities = 29/34 (85%), Positives = 32/34 (94%) Frame = +2 Query: 2 TKFLVDKEGNVVERYAPTTSPKSIEKDIKKYLGV 103 TKFLVDK+GNVVERYAPTTSP SIEKD+KK LG+ Sbjct: 136 TKFLVDKDGNVVERYAPTTSPLSIEKDVKKLLGM 169 >ACN41122.1 unknown [Picea sitchensis] Length = 170 Score = 62.4 bits (150), Expect = 1e-09 Identities = 29/34 (85%), Positives = 31/34 (91%) Frame = +2 Query: 2 TKFLVDKEGNVVERYAPTTSPKSIEKDIKKYLGV 103 TKFLVDK+GNVVERYAPTTSP S EKD+KK LGV Sbjct: 136 TKFLVDKDGNVVERYAPTTSPLSFEKDVKKLLGV 169