BLASTX nr result
ID: Angelica27_contig00027575
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00027575 (714 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017251149.1 PREDICTED: extensin-like [Daucus carota subsp. sa... 74 5e-13 KZM95984.1 hypothetical protein DCAR_019226 [Daucus carota subsp... 74 2e-12 >XP_017251149.1 PREDICTED: extensin-like [Daucus carota subsp. sativus] Length = 160 Score = 74.3 bits (181), Expect = 5e-13 Identities = 32/43 (74%), Positives = 36/43 (83%) Frame = +2 Query: 95 MCSINLIFLFAVSVLLSAITCTDINPETHGEGICQYPDCTPQL 223 MCS+NL++L AVS LLSAI CT INP+T GEG CQYPDC PQL Sbjct: 1 MCSMNLLYLLAVSALLSAINCTKINPDTFGEGTCQYPDCAPQL 43 >KZM95984.1 hypothetical protein DCAR_019226 [Daucus carota subsp. sativus] Length = 250 Score = 74.3 bits (181), Expect = 2e-12 Identities = 32/43 (74%), Positives = 36/43 (83%) Frame = +2 Query: 95 MCSINLIFLFAVSVLLSAITCTDINPETHGEGICQYPDCTPQL 223 MCS+NL++L AVS LLSAI CT INP+T GEG CQYPDC PQL Sbjct: 1 MCSMNLLYLLAVSALLSAINCTKINPDTFGEGTCQYPDCAPQL 43