BLASTX nr result
ID: Angelica27_contig00026484
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00026484 (403 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017255457.1 PREDICTED: zinc finger BED domain-containing prot... 67 1e-11 >XP_017255457.1 PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER-like [Daucus carota subsp. sativus] Length = 659 Score = 67.4 bits (163), Expect(2) = 1e-11 Identities = 32/52 (61%), Positives = 41/52 (78%) Frame = +3 Query: 246 KNHLYISCSNLAGTHHPKRNINMGVCSVGCLSNEDLNKLTPYTPLKTDSTAV 401 K+ YIS + LAGT H KR+I MGVCSV +NE++++L PYTP+KTDSTAV Sbjct: 50 KSFAYISGAKLAGTSHLKRHIKMGVCSVDRRNNEEISQLIPYTPIKTDSTAV 101 Score = 29.3 bits (64), Expect(2) = 1e-11 Identities = 11/18 (61%), Positives = 14/18 (77%) Frame = +1 Query: 154 NELKRKKSTVWNYFLVEK 207 N+ KRK+S VW YF +EK Sbjct: 18 NKRKRKRSIVWQYFSIEK 35