BLASTX nr result
ID: Angelica27_contig00024922
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00024922 (435 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017216528.1 PREDICTED: transcription termination factor MTEF1... 111 7e-26 XP_006445389.1 hypothetical protein CICLE_v10024277mg [Citrus cl... 86 8e-17 KDO85565.1 hypothetical protein CISIN_1g039791mg, partial [Citru... 81 3e-15 KVI07894.1 Mitochodrial transcription termination factor-related... 80 7e-15 CAN60176.1 hypothetical protein VITISV_026394 [Vitis vinifera] 78 6e-14 XP_002272894.1 PREDICTED: transcription termination factor MTEF1... 77 8e-14 XP_018854374.1 PREDICTED: transcription termination factor MTEF1... 77 1e-13 XP_007052277.1 PREDICTED: transcription termination factor MTEF1... 76 2e-13 XP_015889465.1 PREDICTED: uncharacterized protein LOC107424236 [... 76 3e-13 XP_010275376.1 PREDICTED: transcription termination factor MTEF1... 76 3e-13 XP_002511611.1 PREDICTED: uncharacterized protein LOC8265806 [Ri... 74 2e-12 XP_012083673.1 PREDICTED: uncharacterized protein LOC105643202 [... 71 1e-11 XP_011031764.1 PREDICTED: uncharacterized protein LOC105130789 [... 71 1e-11 OMO69563.1 Mitochodrial transcription termination factor-related... 70 1e-11 OMP00723.1 Mitochodrial transcription termination factor-related... 71 1e-11 OAY62498.1 hypothetical protein MANES_01G271800 [Manihot esculenta] 70 3e-11 XP_010413564.1 PREDICTED: transcription termination factor MTEF1... 70 3e-11 XP_012473318.1 PREDICTED: uncharacterized protein LOC105790314 [... 70 4e-11 XP_016725794.1 PREDICTED: uncharacterized protein LOC107937428 [... 69 5e-11 XP_017613032.1 PREDICTED: transcription termination factor MTEF1... 69 5e-11 >XP_017216528.1 PREDICTED: transcription termination factor MTEF18, mitochondrial [Daucus carota subsp. sativus] KZM87972.1 hypothetical protein DCAR_025073 [Daucus carota subsp. sativus] Length = 566 Score = 111 bits (278), Expect = 7e-26 Identities = 51/60 (85%), Positives = 54/60 (90%) Frame = -1 Query: 435 PRYSFHMWLTKNGLCREEYAIPSIIATSEKNFVLRIYRMHRAAPKIWLECYSNKEPGESQ 256 PRYSFH WL KNGLC EEYAIPSIIATSEKNF+ RIYRMHRAAPK+WLE YSNKE G+SQ Sbjct: 499 PRYSFHTWLKKNGLCTEEYAIPSIIATSEKNFISRIYRMHRAAPKLWLERYSNKELGQSQ 558 >XP_006445389.1 hypothetical protein CICLE_v10024277mg [Citrus clementina] XP_006464450.1 PREDICTED: uncharacterized protein LOC102608833 [Citrus sinensis] ESR58629.1 hypothetical protein CICLE_v10024277mg [Citrus clementina] Length = 560 Score = 85.9 bits (211), Expect = 8e-17 Identities = 36/59 (61%), Positives = 46/59 (77%) Frame = -1 Query: 435 PRYSFHMWLTKNGLCREEYAIPSIIATSEKNFVLRIYRMHRAAPKIWLECYSNKEPGES 259 PRY FHMWL +NGLC + Y+I S++ATSEK+F+ RIY +H AAPK WLEC+ K P +S Sbjct: 501 PRYKFHMWLVENGLCTKNYSIASMVATSEKSFISRIYGIHPAAPKQWLECFFCKRPSKS 559 >KDO85565.1 hypothetical protein CISIN_1g039791mg, partial [Citrus sinensis] Length = 552 Score = 81.3 bits (199), Expect = 3e-15 Identities = 33/51 (64%), Positives = 42/51 (82%) Frame = -1 Query: 435 PRYSFHMWLTKNGLCREEYAIPSIIATSEKNFVLRIYRMHRAAPKIWLECY 283 PRY FHMWL +NGLC + Y+I S++ATSEK+F+ RIY +H AAPK WLEC+ Sbjct: 501 PRYKFHMWLVENGLCTKNYSIASMVATSEKSFISRIYGIHPAAPKQWLECF 551 >KVI07894.1 Mitochodrial transcription termination factor-related protein [Cynara cardunculus var. scolymus] Length = 561 Score = 80.5 bits (197), Expect = 7e-15 Identities = 35/63 (55%), Positives = 44/63 (69%) Frame = -1 Query: 435 PRYSFHMWLTKNGLCREEYAIPSIIATSEKNFVLRIYRMHRAAPKIWLECYSNKEPGESQ 256 PRY FHMWL + GLC EY++ SI+ATSE F+ RIYR+H AAPK WLE + N++ Q Sbjct: 499 PRYRFHMWLMETGLCEREYSLASIVATSEVRFIARIYRIHPAAPKKWLELFMNRDYASFQ 558 Query: 255 GES 247 S Sbjct: 559 ETS 561 >CAN60176.1 hypothetical protein VITISV_026394 [Vitis vinifera] Length = 545 Score = 77.8 bits (190), Expect = 6e-14 Identities = 30/52 (57%), Positives = 42/52 (80%) Frame = -1 Query: 435 PRYSFHMWLTKNGLCREEYAIPSIIATSEKNFVLRIYRMHRAAPKIWLECYS 280 PRY H+WL +NGLC + Y++ S+IATSEK+F+ R+Y +H A PK+WLEC+S Sbjct: 489 PRYRXHVWLAENGLCTKNYSLASMIATSEKSFIARLYGIHPAVPKLWLECFS 540 >XP_002272894.1 PREDICTED: transcription termination factor MTEF18, mitochondrial [Vitis vinifera] Length = 561 Score = 77.4 bits (189), Expect = 8e-14 Identities = 30/52 (57%), Positives = 42/52 (80%) Frame = -1 Query: 435 PRYSFHMWLTKNGLCREEYAIPSIIATSEKNFVLRIYRMHRAAPKIWLECYS 280 PRY H+WL +NGLC + Y++ S+IATSEK+F+ R+Y +H A PK+WLEC+S Sbjct: 505 PRYRCHVWLAENGLCTKNYSLASMIATSEKSFIARLYGIHPAVPKLWLECFS 556 >XP_018854374.1 PREDICTED: transcription termination factor MTEF18, mitochondrial [Juglans regia] Length = 557 Score = 76.6 bits (187), Expect = 1e-13 Identities = 34/56 (60%), Positives = 41/56 (73%) Frame = -1 Query: 435 PRYSFHMWLTKNGLCREEYAIPSIIATSEKNFVLRIYRMHRAAPKIWLECYSNKEP 268 PRY FH+WL + G C + Y+I SIIATSEKNFV R+ +H APK W E YSNK+P Sbjct: 499 PRYRFHVWLAEKGFCTKTYSIASIIATSEKNFVARLSAIHPDAPKWWSEHYSNKKP 554 >XP_007052277.1 PREDICTED: transcription termination factor MTEF18, mitochondrial [Theobroma cacao] EOX96434.1 Mitochondrial transcription termination factor family protein, putative [Theobroma cacao] Length = 560 Score = 76.3 bits (186), Expect = 2e-13 Identities = 32/59 (54%), Positives = 44/59 (74%) Frame = -1 Query: 435 PRYSFHMWLTKNGLCREEYAIPSIIATSEKNFVLRIYRMHRAAPKIWLECYSNKEPGES 259 PRY FH WLT+ GLC + Y+I S++ATSEK+FV R+Y +H APK W E +S ++P +S Sbjct: 501 PRYRFHKWLTEKGLCTKNYSIASMVATSEKSFVARLYGIHPDAPKQWFENFSCRKPSDS 559 >XP_015889465.1 PREDICTED: uncharacterized protein LOC107424236 [Ziziphus jujuba] Length = 565 Score = 75.9 bits (185), Expect = 3e-13 Identities = 33/54 (61%), Positives = 42/54 (77%) Frame = -1 Query: 435 PRYSFHMWLTKNGLCREEYAIPSIIATSEKNFVLRIYRMHRAAPKIWLECYSNK 274 PRY FH+WLT+ GLC + Y+I S+IATSEK+FV R+ +H AAPK WLEC+ K Sbjct: 510 PRYRFHVWLTERGLCSKNYSIASMIATSEKSFVSRLSGIHPAAPKQWLECFLYK 563 >XP_010275376.1 PREDICTED: transcription termination factor MTEF18, mitochondrial [Nelumbo nucifera] Length = 569 Score = 75.9 bits (185), Expect = 3e-13 Identities = 34/63 (53%), Positives = 44/63 (69%) Frame = -1 Query: 435 PRYSFHMWLTKNGLCREEYAIPSIIATSEKNFVLRIYRMHRAAPKIWLECYSNKEPGESQ 256 PR+ HMWL + GL + Y+I SIIA SEK F+ R++ +H AAPK WLEC+S K G SQ Sbjct: 504 PRFRIHMWLKQMGLVTKNYSIASIIADSEKKFIARLFNIHPAAPKQWLECFSCKNLGNSQ 563 Query: 255 GES 247 E+ Sbjct: 564 QET 566 >XP_002511611.1 PREDICTED: uncharacterized protein LOC8265806 [Ricinus communis] XP_015584428.1 PREDICTED: uncharacterized protein LOC8265806 [Ricinus communis] XP_015584429.1 PREDICTED: uncharacterized protein LOC8265806 [Ricinus communis] EEF50280.1 conserved hypothetical protein [Ricinus communis] Length = 561 Score = 73.6 bits (179), Expect = 2e-12 Identities = 32/56 (57%), Positives = 40/56 (71%) Frame = -1 Query: 435 PRYSFHMWLTKNGLCREEYAIPSIIATSEKNFVLRIYRMHRAAPKIWLECYSNKEP 268 PRY FHMWLT+ G+ + Y+I SI+ATSEKNFV R+Y +H A PK W E K+P Sbjct: 495 PRYRFHMWLTEKGVSTQTYSISSIVATSEKNFVARLYGIHPAVPKHWFEFLMPKKP 550 >XP_012083673.1 PREDICTED: uncharacterized protein LOC105643202 [Jatropha curcas] Length = 547 Score = 71.2 bits (173), Expect = 1e-11 Identities = 31/52 (59%), Positives = 38/52 (73%) Frame = -1 Query: 435 PRYSFHMWLTKNGLCREEYAIPSIIATSEKNFVLRIYRMHRAAPKIWLECYS 280 PRY FHMWL + G C + Y+I SI+ATSEKNF+ RIY +H AA K W E +S Sbjct: 495 PRYRFHMWLKERGFCMQNYSISSIVATSEKNFMARIYGIHPAALKHWFERFS 546 >XP_011031764.1 PREDICTED: uncharacterized protein LOC105130789 [Populus euphratica] XP_011031772.1 PREDICTED: uncharacterized protein LOC105130789 [Populus euphratica] XP_011031778.1 PREDICTED: uncharacterized protein LOC105130789 [Populus euphratica] XP_011031787.1 PREDICTED: uncharacterized protein LOC105130789 [Populus euphratica] XP_011031795.1 PREDICTED: uncharacterized protein LOC105130789 [Populus euphratica] XP_011031802.1 PREDICTED: uncharacterized protein LOC105130789 [Populus euphratica] Length = 557 Score = 71.2 bits (173), Expect = 1e-11 Identities = 28/54 (51%), Positives = 43/54 (79%) Frame = -1 Query: 435 PRYSFHMWLTKNGLCREEYAIPSIIATSEKNFVLRIYRMHRAAPKIWLECYSNK 274 PR+ FHMWLT+ G C++EY+I SI+ATS+K+FV R++ +H APK+W++ +K Sbjct: 502 PRHRFHMWLTERGFCKQEYSIASIVATSDKSFVARLHVIHPDAPKLWVDFSHSK 555 >OMO69563.1 Mitochodrial transcription termination factor-related protein [Corchorus capsularis] Length = 267 Score = 70.1 bits (170), Expect = 1e-11 Identities = 32/59 (54%), Positives = 40/59 (67%) Frame = -1 Query: 435 PRYSFHMWLTKNGLCREEYAIPSIIATSEKNFVLRIYRMHRAAPKIWLECYSNKEPGES 259 PRY FH WLT+ GL Y+I SI+ATSEKNF+ RI+ +H A K W E YS +P E+ Sbjct: 208 PRYRFHRWLTETGLSTRNYSIASIVATSEKNFIARIHGIHPDAVKEWYEKYSCSKPDEN 266 >OMP00723.1 Mitochodrial transcription termination factor-related protein [Corchorus olitorius] Length = 560 Score = 70.9 bits (172), Expect = 1e-11 Identities = 32/59 (54%), Positives = 40/59 (67%) Frame = -1 Query: 435 PRYSFHMWLTKNGLCREEYAIPSIIATSEKNFVLRIYRMHRAAPKIWLECYSNKEPGES 259 PRY FH WLT+ G C Y+I SI+ATSEKNFV R++ +H A K W E YS +P E+ Sbjct: 501 PRYRFHKWLTEKGWCTRNYSIASIVATSEKNFVARMHGIHPDAVKEWYEKYSCSKPDEN 559 >OAY62498.1 hypothetical protein MANES_01G271800 [Manihot esculenta] Length = 548 Score = 70.1 bits (170), Expect = 3e-11 Identities = 32/52 (61%), Positives = 39/52 (75%) Frame = -1 Query: 435 PRYSFHMWLTKNGLCREEYAIPSIIATSEKNFVLRIYRMHRAAPKIWLECYS 280 PRY FHMWLT G ++Y+I SI+ATSEKNF+ RIY +H AA K W EC+S Sbjct: 498 PRYRFHMWLTDRGA--QKYSIASIVATSEKNFIARIYGIHPAALKHWFECFS 547 >XP_010413564.1 PREDICTED: transcription termination factor MTEF18, mitochondrial-like [Camelina sativa] Length = 558 Score = 70.1 bits (170), Expect = 3e-11 Identities = 29/55 (52%), Positives = 40/55 (72%) Frame = -1 Query: 435 PRYSFHMWLTKNGLCREEYAIPSIIATSEKNFVLRIYRMHRAAPKIWLECYSNKE 271 PR+ FH WL +NGL + Y+I SI+ATSEK F+ R+Y +H A PK W E +SN++ Sbjct: 498 PRFRFHKWLVENGLSEKSYSIASIVATSEKAFIARLYGIHPAIPKHWFERFSNRK 552 >XP_012473318.1 PREDICTED: uncharacterized protein LOC105790314 [Gossypium raimondii] KJB22289.1 hypothetical protein B456_004G039400 [Gossypium raimondii] Length = 564 Score = 69.7 bits (169), Expect = 4e-11 Identities = 31/59 (52%), Positives = 39/59 (66%) Frame = -1 Query: 435 PRYSFHMWLTKNGLCREEYAIPSIIATSEKNFVLRIYRMHRAAPKIWLECYSNKEPGES 259 PRY FH WLT+NGLC Y+I SI+AT EK+F+ R+ R+H A W E +S KE S Sbjct: 503 PRYRFHKWLTENGLCTRNYSIASIVATGEKSFIARLGRIHPDALNEWFENFSYKESNNS 561 >XP_016725794.1 PREDICTED: uncharacterized protein LOC107937428 [Gossypium hirsutum] Length = 543 Score = 69.3 bits (168), Expect = 5e-11 Identities = 31/59 (52%), Positives = 39/59 (66%) Frame = -1 Query: 435 PRYSFHMWLTKNGLCREEYAIPSIIATSEKNFVLRIYRMHRAAPKIWLECYSNKEPGES 259 PRY FH WLT+NGLC Y+I SI+AT EK+F+ R+ R+H A W E +S KE S Sbjct: 482 PRYRFHKWLTENGLCTRNYSIASIVATGEKSFIARLGRIHPDALNKWFENFSYKESDNS 540 >XP_017613032.1 PREDICTED: transcription termination factor MTEF18, mitochondrial [Gossypium arboreum] Length = 564 Score = 69.3 bits (168), Expect = 5e-11 Identities = 31/59 (52%), Positives = 39/59 (66%) Frame = -1 Query: 435 PRYSFHMWLTKNGLCREEYAIPSIIATSEKNFVLRIYRMHRAAPKIWLECYSNKEPGES 259 PRY FH WLT+NGLC Y+I SI+AT EK+F+ R+ R+H A W E +S KE S Sbjct: 503 PRYRFHKWLTENGLCTRNYSIASIVATGEKSFIARLGRIHPDALNKWFENFSYKESDSS 561