BLASTX nr result
ID: Angelica27_contig00024899
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00024899 (269 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017236494.1 PREDICTED: pentatricopeptide repeat-containing pr... 176 2e-49 XP_015899808.1 PREDICTED: pentatricopeptide repeat-containing pr... 147 3e-39 XP_015899806.1 PREDICTED: pentatricopeptide repeat-containing pr... 147 3e-39 CBI31086.3 unnamed protein product, partial [Vitis vinifera] 145 2e-38 XP_019077990.1 PREDICTED: pentatricopeptide repeat-containing pr... 145 2e-38 JAT53759.1 Pentatricopeptide repeat-containing protein At4g21300... 134 2e-38 XP_016648944.1 PREDICTED: pentatricopeptide repeat-containing pr... 144 2e-38 XP_004135750.2 PREDICTED: pentatricopeptide repeat-containing pr... 144 3e-38 XP_008245930.2 PREDICTED: pentatricopeptide repeat-containing pr... 143 5e-38 JAU64636.1 Pentatricopeptide repeat-containing protein, partial ... 134 7e-38 XP_007198953.1 hypothetical protein PRUPE_ppa018505mg [Prunus pe... 143 7e-38 XP_008245917.1 PREDICTED: LOW QUALITY PROTEIN: pentatricopeptide... 140 7e-38 ONI17055.1 hypothetical protein PRUPE_3G135500 [Prunus persica] 143 8e-38 JAU06717.1 Pentatricopeptide repeat-containing protein, partial ... 134 1e-37 EOY25610.1 Tetratricopeptide repeat (TPR)-like superfamily prote... 142 2e-37 XP_007022990.2 PREDICTED: pentatricopeptide repeat-containing pr... 142 2e-37 EOY25609.1 Tetratricopeptide repeat (TPR)-like superfamily prote... 142 2e-37 XP_019161582.1 PREDICTED: pentatricopeptide repeat-containing pr... 141 3e-37 XP_019161581.1 PREDICTED: pentatricopeptide repeat-containing pr... 141 3e-37 XP_019161580.1 PREDICTED: pentatricopeptide repeat-containing pr... 141 3e-37 >XP_017236494.1 PREDICTED: pentatricopeptide repeat-containing protein At4g21300 [Daucus carota subsp. sativus] XP_017236495.1 PREDICTED: pentatricopeptide repeat-containing protein At4g21300 [Daucus carota subsp. sativus] XP_017236496.1 PREDICTED: pentatricopeptide repeat-containing protein At4g21300 [Daucus carota subsp. sativus] XP_017236497.1 PREDICTED: pentatricopeptide repeat-containing protein At4g21300 [Daucus carota subsp. sativus] XP_017236498.1 PREDICTED: pentatricopeptide repeat-containing protein At4g21300 [Daucus carota subsp. sativus] XP_017236500.1 PREDICTED: pentatricopeptide repeat-containing protein At4g21300 [Daucus carota subsp. sativus] XP_017236501.1 PREDICTED: pentatricopeptide repeat-containing protein At4g21300 [Daucus carota subsp. sativus] XP_017236502.1 PREDICTED: pentatricopeptide repeat-containing protein At4g21300 [Daucus carota subsp. sativus] XP_017236503.1 PREDICTED: pentatricopeptide repeat-containing protein At4g21300 [Daucus carota subsp. sativus] XP_017236504.1 PREDICTED: pentatricopeptide repeat-containing protein At4g21300 [Daucus carota subsp. sativus] XP_017236505.1 PREDICTED: pentatricopeptide repeat-containing protein At4g21300 [Daucus carota subsp. sativus] XP_017236506.1 PREDICTED: pentatricopeptide repeat-containing protein At4g21300 [Daucus carota subsp. sativus] XP_017236507.1 PREDICTED: pentatricopeptide repeat-containing protein At4g21300 [Daucus carota subsp. sativus] XP_017236508.1 PREDICTED: pentatricopeptide repeat-containing protein At4g21300 [Daucus carota subsp. sativus] XP_017236509.1 PREDICTED: pentatricopeptide repeat-containing protein At4g21300 [Daucus carota subsp. sativus] XP_017236510.1 PREDICTED: pentatricopeptide repeat-containing protein At4g21300 [Daucus carota subsp. sativus] XP_017236511.1 PREDICTED: pentatricopeptide repeat-containing protein At4g21300 [Daucus carota subsp. sativus] XP_017236512.1 PREDICTED: pentatricopeptide repeat-containing protein At4g21300 [Daucus carota subsp. sativus] Length = 842 Score = 176 bits (445), Expect = 2e-49 Identities = 84/89 (94%), Positives = 86/89 (96%) Frame = -2 Query: 268 RAGRLEEAYEFIKCMPFEPDAGVWGTLLGACRVHGNVDLAELAAGNLFNLDPQNSGYYVL 89 RAGRLEEAYEFIKCMPF+PDAGVWGTLLGACRVHGNVDLAELAAGNLFNLDPQNSGYYVL Sbjct: 688 RAGRLEEAYEFIKCMPFDPDAGVWGTLLGACRVHGNVDLAELAAGNLFNLDPQNSGYYVL 747 Query: 88 LANTQADAGKWERVLKTRSIMKERGVQKI 2 LAN QA AGKWE VLKTRS+MKERGVQKI Sbjct: 748 LANAQAGAGKWEGVLKTRSMMKERGVQKI 776 >XP_015899808.1 PREDICTED: pentatricopeptide repeat-containing protein At4g21300 isoform X2 [Ziziphus jujuba] Length = 814 Score = 147 bits (371), Expect = 3e-39 Identities = 68/89 (76%), Positives = 79/89 (88%) Frame = -2 Query: 268 RAGRLEEAYEFIKCMPFEPDAGVWGTLLGACRVHGNVDLAELAAGNLFNLDPQNSGYYVL 89 RAGRL EA+E I+ MPF PDAGVWGTLLGACRVHGNV+LAE+A+ NLF+LDPQNSGYY+L Sbjct: 663 RAGRLNEAFETIQSMPFSPDAGVWGTLLGACRVHGNVELAEVASKNLFDLDPQNSGYYIL 722 Query: 88 LANTQADAGKWERVLKTRSIMKERGVQKI 2 L+N ADAGKW RVL+ R +MKERGVQK+ Sbjct: 723 LSNINADAGKWGRVLEIRRLMKERGVQKV 751 >XP_015899806.1 PREDICTED: pentatricopeptide repeat-containing protein At4g21300 isoform X1 [Ziziphus jujuba] XP_015899807.1 PREDICTED: pentatricopeptide repeat-containing protein At4g21300 isoform X1 [Ziziphus jujuba] Length = 848 Score = 147 bits (371), Expect = 3e-39 Identities = 68/89 (76%), Positives = 79/89 (88%) Frame = -2 Query: 268 RAGRLEEAYEFIKCMPFEPDAGVWGTLLGACRVHGNVDLAELAAGNLFNLDPQNSGYYVL 89 RAGRL EA+E I+ MPF PDAGVWGTLLGACRVHGNV+LAE+A+ NLF+LDPQNSGYY+L Sbjct: 697 RAGRLNEAFETIQSMPFSPDAGVWGTLLGACRVHGNVELAEVASKNLFDLDPQNSGYYIL 756 Query: 88 LANTQADAGKWERVLKTRSIMKERGVQKI 2 L+N ADAGKW RVL+ R +MKERGVQK+ Sbjct: 757 LSNINADAGKWGRVLEIRRLMKERGVQKV 785 >CBI31086.3 unnamed protein product, partial [Vitis vinifera] Length = 766 Score = 145 bits (365), Expect = 2e-38 Identities = 67/89 (75%), Positives = 78/89 (87%) Frame = -2 Query: 268 RAGRLEEAYEFIKCMPFEPDAGVWGTLLGACRVHGNVDLAELAAGNLFNLDPQNSGYYVL 89 RAGRL EA+ I MPF PDAGVWGTLLGACR+HGNV+LAE+A+ NLF+LDPQNSGYYVL Sbjct: 601 RAGRLNEAFGMINSMPFSPDAGVWGTLLGACRLHGNVELAEVASRNLFDLDPQNSGYYVL 660 Query: 88 LANTQADAGKWERVLKTRSIMKERGVQKI 2 L+N A+AG+WE VLK RS+MKERGVQK+ Sbjct: 661 LSNVHANAGQWESVLKIRSLMKERGVQKV 689 >XP_019077990.1 PREDICTED: pentatricopeptide repeat-containing protein At4g21300 [Vitis vinifera] Length = 853 Score = 145 bits (365), Expect = 2e-38 Identities = 67/89 (75%), Positives = 78/89 (87%) Frame = -2 Query: 268 RAGRLEEAYEFIKCMPFEPDAGVWGTLLGACRVHGNVDLAELAAGNLFNLDPQNSGYYVL 89 RAGRL EA+ I MPF PDAGVWGTLLGACR+HGNV+LAE+A+ NLF+LDPQNSGYYVL Sbjct: 700 RAGRLNEAFGMINSMPFSPDAGVWGTLLGACRLHGNVELAEVASRNLFDLDPQNSGYYVL 759 Query: 88 LANTQADAGKWERVLKTRSIMKERGVQKI 2 L+N A+AG+WE VLK RS+MKERGVQK+ Sbjct: 760 LSNVHANAGQWESVLKIRSLMKERGVQKV 788 >JAT53759.1 Pentatricopeptide repeat-containing protein At4g21300, partial [Anthurium amnicola] Length = 145 Score = 134 bits (336), Expect = 2e-38 Identities = 63/89 (70%), Positives = 75/89 (84%) Frame = -2 Query: 268 RAGRLEEAYEFIKCMPFEPDAGVWGTLLGACRVHGNVDLAELAAGNLFNLDPQNSGYYVL 89 RAGRL EA +FIK MPF+PD G+WG LLGAC+VH NV+LAELA+ +LF LDPQNSGYY+L Sbjct: 11 RAGRLIEALDFIKGMPFQPDPGIWGALLGACKVHTNVELAELASHHLFKLDPQNSGYYML 70 Query: 88 LANTQADAGKWERVLKTRSIMKERGVQKI 2 L+N A AG+WERV K RS+MKER VQK+ Sbjct: 71 LSNIHAVAGRWERVSKVRSLMKERKVQKL 99 >XP_016648944.1 PREDICTED: pentatricopeptide repeat-containing protein At4g21300-like [Prunus mume] Length = 652 Score = 144 bits (363), Expect = 2e-38 Identities = 67/89 (75%), Positives = 78/89 (87%) Frame = -2 Query: 268 RAGRLEEAYEFIKCMPFEPDAGVWGTLLGACRVHGNVDLAELAAGNLFNLDPQNSGYYVL 89 RAGRL EA+E IK MPF PD+GVWGTLLGACRVHGNV+LAE A+ +LF+L+PQNSGYY+L Sbjct: 505 RAGRLSEAFETIKSMPFSPDSGVWGTLLGACRVHGNVELAEEASRHLFDLEPQNSGYYIL 564 Query: 88 LANTQADAGKWERVLKTRSIMKERGVQKI 2 L+N ADAGKW VLK RS+MKERGVQK+ Sbjct: 565 LSNIHADAGKWGSVLKVRSLMKERGVQKV 593 >XP_004135750.2 PREDICTED: pentatricopeptide repeat-containing protein At4g21300-like [Cucumis sativus] XP_011659873.1 PREDICTED: pentatricopeptide repeat-containing protein At4g21300-like [Cucumis sativus] KGN65963.1 hypothetical protein Csa_1G553510 [Cucumis sativus] Length = 848 Score = 144 bits (363), Expect = 3e-38 Identities = 67/89 (75%), Positives = 78/89 (87%) Frame = -2 Query: 268 RAGRLEEAYEFIKCMPFEPDAGVWGTLLGACRVHGNVDLAELAAGNLFNLDPQNSGYYVL 89 RAGRL+EA+E I MPF PDAGVWGTLLGAC +HGNV+LAE+A+ +LF+LDP NSGYYVL Sbjct: 697 RAGRLDEAFETINSMPFPPDAGVWGTLLGACHIHGNVELAEVASKHLFDLDPLNSGYYVL 756 Query: 88 LANTQADAGKWERVLKTRSIMKERGVQKI 2 LAN QA AGKW +VLK RSIMKERGV+K+ Sbjct: 757 LANVQAGAGKWRKVLKVRSIMKERGVRKV 785 >XP_008245930.2 PREDICTED: pentatricopeptide repeat-containing protein At4g21300-like, partial [Prunus mume] Length = 646 Score = 143 bits (360), Expect = 5e-38 Identities = 66/89 (74%), Positives = 78/89 (87%) Frame = -2 Query: 268 RAGRLEEAYEFIKCMPFEPDAGVWGTLLGACRVHGNVDLAELAAGNLFNLDPQNSGYYVL 89 RAGRL EA+E IK MPF PD+GVWGTLLGACRVHGNV+LAE A+ +LF+++PQNSGYY+L Sbjct: 499 RAGRLSEAFETIKSMPFSPDSGVWGTLLGACRVHGNVELAEEASRHLFDVEPQNSGYYIL 558 Query: 88 LANTQADAGKWERVLKTRSIMKERGVQKI 2 L+N ADAGKW VLK RS+MKERGVQK+ Sbjct: 559 LSNIHADAGKWGSVLKVRSLMKERGVQKV 587 >JAU64636.1 Pentatricopeptide repeat-containing protein, partial [Noccaea caerulescens] Length = 189 Score = 134 bits (336), Expect = 7e-38 Identities = 61/89 (68%), Positives = 76/89 (85%) Frame = -2 Query: 268 RAGRLEEAYEFIKCMPFEPDAGVWGTLLGACRVHGNVDLAELAAGNLFNLDPQNSGYYVL 89 RAGRLEEAYE +K MPF PDAGVWGTLLGACR+H N++LA++A+ L +LDP+NSGYYVL Sbjct: 74 RAGRLEEAYETVKSMPFPPDAGVWGTLLGACRLHKNIELAKVASRRLMDLDPRNSGYYVL 133 Query: 88 LANTQADAGKWERVLKTRSIMKERGVQKI 2 ++N A+AG+W V + RS+MKERGVQKI Sbjct: 134 MSNAHANAGEWGGVTEVRSLMKERGVQKI 162 >XP_007198953.1 hypothetical protein PRUPE_ppa018505mg [Prunus persica] Length = 758 Score = 143 bits (360), Expect = 7e-38 Identities = 66/89 (74%), Positives = 78/89 (87%) Frame = -2 Query: 268 RAGRLEEAYEFIKCMPFEPDAGVWGTLLGACRVHGNVDLAELAAGNLFNLDPQNSGYYVL 89 RAGRL EA+E IK MPF PD+GVWGTLLGACRVHGNV+LAE A+ +LF+++PQNSGYY+L Sbjct: 611 RAGRLSEAFETIKSMPFSPDSGVWGTLLGACRVHGNVELAEEASRHLFDVEPQNSGYYIL 670 Query: 88 LANTQADAGKWERVLKTRSIMKERGVQKI 2 L+N ADAGKW VLK RS+MKERGVQK+ Sbjct: 671 LSNIHADAGKWGSVLKVRSLMKERGVQKV 699 >XP_008245917.1 PREDICTED: LOW QUALITY PROTEIN: pentatricopeptide repeat-containing protein At4g21300-like, partial [Prunus mume] Length = 441 Score = 140 bits (352), Expect = 7e-38 Identities = 65/89 (73%), Positives = 77/89 (86%) Frame = -2 Query: 268 RAGRLEEAYEFIKCMPFEPDAGVWGTLLGACRVHGNVDLAELAAGNLFNLDPQNSGYYVL 89 RAGRL EA+E IK MPF PD+ VWGTLLGACRVHGNV+LAE A+ +LF+++PQNSGYY+L Sbjct: 294 RAGRLSEAFETIKSMPFSPDSVVWGTLLGACRVHGNVELAEEASXHLFDVEPQNSGYYIL 353 Query: 88 LANTQADAGKWERVLKTRSIMKERGVQKI 2 L+N ADAGKW VLK RS+MKERGVQK+ Sbjct: 354 LSNIHADAGKWGSVLKVRSLMKERGVQKV 382 >ONI17055.1 hypothetical protein PRUPE_3G135500 [Prunus persica] Length = 784 Score = 143 bits (360), Expect = 8e-38 Identities = 66/89 (74%), Positives = 78/89 (87%) Frame = -2 Query: 268 RAGRLEEAYEFIKCMPFEPDAGVWGTLLGACRVHGNVDLAELAAGNLFNLDPQNSGYYVL 89 RAGRL EA+E IK MPF PD+GVWGTLLGACRVHGNV+LAE A+ +LF+++PQNSGYY+L Sbjct: 637 RAGRLSEAFETIKSMPFSPDSGVWGTLLGACRVHGNVELAEEASRHLFDVEPQNSGYYIL 696 Query: 88 LANTQADAGKWERVLKTRSIMKERGVQKI 2 L+N ADAGKW VLK RS+MKERGVQK+ Sbjct: 697 LSNIHADAGKWGSVLKVRSLMKERGVQKV 725 >JAU06717.1 Pentatricopeptide repeat-containing protein, partial [Noccaea caerulescens] Length = 227 Score = 134 bits (337), Expect = 1e-37 Identities = 62/89 (69%), Positives = 76/89 (85%) Frame = -2 Query: 268 RAGRLEEAYEFIKCMPFEPDAGVWGTLLGACRVHGNVDLAELAAGNLFNLDPQNSGYYVL 89 RAGRLEEAYE +K MPF PDAGVWGTLLGACR+H NV+LA++A+ L +LDP+NSGYYVL Sbjct: 57 RAGRLEEAYETVKSMPFPPDAGVWGTLLGACRLHKNVELAKVASRRLMDLDPRNSGYYVL 116 Query: 88 LANTQADAGKWERVLKTRSIMKERGVQKI 2 ++N A+AG+W V + RS+MKERGVQKI Sbjct: 117 MSNAHANAGEWGGVTEVRSLMKERGVQKI 145 >EOY25610.1 Tetratricopeptide repeat (TPR)-like superfamily protein, putative isoform 2 [Theobroma cacao] Length = 805 Score = 142 bits (358), Expect = 2e-37 Identities = 68/89 (76%), Positives = 76/89 (85%) Frame = -2 Query: 268 RAGRLEEAYEFIKCMPFEPDAGVWGTLLGACRVHGNVDLAELAAGNLFNLDPQNSGYYVL 89 RAGRL EA+E IK MPF PDAGVWGTLLGACR HGNV+LAE A+ +LF+LDPQNSGYYVL Sbjct: 658 RAGRLNEAFETIKSMPFSPDAGVWGTLLGACRNHGNVELAEFASRHLFDLDPQNSGYYVL 717 Query: 88 LANTQADAGKWERVLKTRSIMKERGVQKI 2 L+N ADAG W VLK RS+MKERGVQK+ Sbjct: 718 LSNLLADAGHWGSVLKIRSLMKERGVQKV 746 >XP_007022990.2 PREDICTED: pentatricopeptide repeat-containing protein At4g21300 [Theobroma cacao] XP_017979118.1 PREDICTED: pentatricopeptide repeat-containing protein At4g21300 [Theobroma cacao] XP_007022987.2 PREDICTED: pentatricopeptide repeat-containing protein At4g21300 [Theobroma cacao] XP_007022991.2 PREDICTED: pentatricopeptide repeat-containing protein At4g21300 [Theobroma cacao] XP_017979119.1 PREDICTED: pentatricopeptide repeat-containing protein At4g21300 [Theobroma cacao] XP_007022989.2 PREDICTED: pentatricopeptide repeat-containing protein At4g21300 [Theobroma cacao] XP_017979120.1 PREDICTED: pentatricopeptide repeat-containing protein At4g21300 [Theobroma cacao] Length = 833 Score = 142 bits (358), Expect = 2e-37 Identities = 68/89 (76%), Positives = 76/89 (85%) Frame = -2 Query: 268 RAGRLEEAYEFIKCMPFEPDAGVWGTLLGACRVHGNVDLAELAAGNLFNLDPQNSGYYVL 89 RAGRL EA+E IK MPF PDAGVWGTLLGACR HGNV+LAE A+ +LF+LDPQNSGYYVL Sbjct: 686 RAGRLNEAFETIKSMPFSPDAGVWGTLLGACRNHGNVELAEFASRHLFDLDPQNSGYYVL 745 Query: 88 LANTQADAGKWERVLKTRSIMKERGVQKI 2 L+N ADAG W VLK RS+MKERGVQK+ Sbjct: 746 LSNLLADAGHWGSVLKIRSLMKERGVQKV 774 >EOY25609.1 Tetratricopeptide repeat (TPR)-like superfamily protein, putative isoform 1 [Theobroma cacao] EOY25611.1 Tetratricopeptide repeat (TPR)-like superfamily protein, putative isoform 1 [Theobroma cacao] EOY25612.1 Tetratricopeptide repeat (TPR)-like superfamily protein, putative isoform 1 [Theobroma cacao] EOY25613.1 Tetratricopeptide repeat (TPR)-like superfamily protein, putative isoform 1 [Theobroma cacao] EOY25614.1 Tetratricopeptide repeat (TPR)-like superfamily protein, putative isoform 1 [Theobroma cacao] Length = 833 Score = 142 bits (358), Expect = 2e-37 Identities = 68/89 (76%), Positives = 76/89 (85%) Frame = -2 Query: 268 RAGRLEEAYEFIKCMPFEPDAGVWGTLLGACRVHGNVDLAELAAGNLFNLDPQNSGYYVL 89 RAGRL EA+E IK MPF PDAGVWGTLLGACR HGNV+LAE A+ +LF+LDPQNSGYYVL Sbjct: 686 RAGRLNEAFETIKSMPFSPDAGVWGTLLGACRNHGNVELAEFASRHLFDLDPQNSGYYVL 745 Query: 88 LANTQADAGKWERVLKTRSIMKERGVQKI 2 L+N ADAG W VLK RS+MKERGVQK+ Sbjct: 746 LSNLLADAGHWGSVLKIRSLMKERGVQKV 774 >XP_019161582.1 PREDICTED: pentatricopeptide repeat-containing protein At4g21300 isoform X4 [Ipomoea nil] Length = 747 Score = 141 bits (356), Expect = 3e-37 Identities = 67/89 (75%), Positives = 77/89 (86%) Frame = -2 Query: 268 RAGRLEEAYEFIKCMPFEPDAGVWGTLLGACRVHGNVDLAELAAGNLFNLDPQNSGYYVL 89 RAG LEEA+E IK MP DAG+WGTLLGACRVHG+V+LAE+A+ LFNLDPQNSGYYVL Sbjct: 609 RAGCLEEAFEVIKSMPITADAGIWGTLLGACRVHGHVELAEMASKYLFNLDPQNSGYYVL 668 Query: 88 LANTQADAGKWERVLKTRSIMKERGVQKI 2 L+N QAD+G+WER K RS+MKERGVQKI Sbjct: 669 LSNLQADSGEWERASKIRSLMKERGVQKI 697 >XP_019161581.1 PREDICTED: pentatricopeptide repeat-containing protein At4g21300 isoform X3 [Ipomoea nil] Length = 768 Score = 141 bits (356), Expect = 3e-37 Identities = 67/89 (75%), Positives = 77/89 (86%) Frame = -2 Query: 268 RAGRLEEAYEFIKCMPFEPDAGVWGTLLGACRVHGNVDLAELAAGNLFNLDPQNSGYYVL 89 RAG LEEA+E IK MP DAG+WGTLLGACRVHG+V+LAE+A+ LFNLDPQNSGYYVL Sbjct: 630 RAGCLEEAFEVIKSMPITADAGIWGTLLGACRVHGHVELAEMASKYLFNLDPQNSGYYVL 689 Query: 88 LANTQADAGKWERVLKTRSIMKERGVQKI 2 L+N QAD+G+WER K RS+MKERGVQKI Sbjct: 690 LSNLQADSGEWERASKIRSLMKERGVQKI 718 >XP_019161580.1 PREDICTED: pentatricopeptide repeat-containing protein At4g21300 isoform X2 [Ipomoea nil] Length = 804 Score = 141 bits (356), Expect = 3e-37 Identities = 67/89 (75%), Positives = 77/89 (86%) Frame = -2 Query: 268 RAGRLEEAYEFIKCMPFEPDAGVWGTLLGACRVHGNVDLAELAAGNLFNLDPQNSGYYVL 89 RAG LEEA+E IK MP DAG+WGTLLGACRVHG+V+LAE+A+ LFNLDPQNSGYYVL Sbjct: 666 RAGCLEEAFEVIKSMPITADAGIWGTLLGACRVHGHVELAEMASKYLFNLDPQNSGYYVL 725 Query: 88 LANTQADAGKWERVLKTRSIMKERGVQKI 2 L+N QAD+G+WER K RS+MKERGVQKI Sbjct: 726 LSNLQADSGEWERASKIRSLMKERGVQKI 754