BLASTX nr result
ID: Angelica27_contig00024859
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00024859 (400 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KZN08878.1 hypothetical protein DCAR_001534 [Daucus carota subsp... 54 7e-06 >KZN08878.1 hypothetical protein DCAR_001534 [Daucus carota subsp. sativus] Length = 231 Score = 53.5 bits (127), Expect = 7e-06 Identities = 30/43 (69%), Positives = 33/43 (76%) Frame = -3 Query: 398 NR*LLLRFCNGIYDAQTIIPSFSFVSHIEALPHGPPLQSSLKP 270 NR LLLRFC G+YDAQTIIP SF+ I+AL PP QSSLKP Sbjct: 194 NRGLLLRFCKGLYDAQTIIP--SFILQIDAL---PPPQSSLKP 231