BLASTX nr result
ID: Angelica27_contig00024739
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00024739 (353 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017219461.1 PREDICTED: guanine nucleotide-binding protein sub... 67 1e-10 AAN86757.1 G-protein beta-subunit/auxin-regulated protein, parti... 59 1e-09 XP_019240559.1 PREDICTED: guanine nucleotide-binding protein sub... 63 3e-09 XP_016457872.1 PREDICTED: guanine nucleotide-binding protein sub... 62 6e-09 XP_009780116.1 PREDICTED: guanine nucleotide-binding protein sub... 62 6e-09 XP_009611065.1 PREDICTED: guanine nucleotide-binding protein sub... 62 6e-09 KVI07882.1 G-protein beta WD-40 repeat-containing protein [Cynar... 62 6e-09 KVI04616.1 G-protein beta WD-40 repeat-containing protein [Cynar... 62 6e-09 XP_016555915.1 PREDICTED: guanine nucleotide-binding protein sub... 60 4e-08 XP_019239450.1 PREDICTED: guanine nucleotide-binding protein sub... 59 6e-08 P93340.1 RecName: Full=Guanine nucleotide-binding protein subuni... 59 6e-08 XP_009778426.1 PREDICTED: guanine nucleotide-binding protein sub... 59 6e-08 XP_009624187.1 PREDICTED: guanine nucleotide-binding protein sub... 59 6e-08 ACR77528.1 heterotrimeric G protein beta 1 subunit [Nicotiana be... 59 6e-08 EYU40229.1 hypothetical protein MIMGU_mgv1a008949mg [Erythranthe... 59 6e-08 XP_011084467.1 PREDICTED: LOW QUALITY PROTEIN: guanine nucleotid... 59 8e-08 JAU54828.1 Guanine nucleotide-binding protein subunit beta-like ... 59 8e-08 XP_004252271.1 PREDICTED: guanine nucleotide-binding protein sub... 59 1e-07 NP_001233881.2 ArcA2 protein [Solanum lycopersicum] XP_015070006... 59 1e-07 NP_001233876.2 ArcA1 protein [Solanum lycopersicum] XP_015079379... 59 1e-07 >XP_017219461.1 PREDICTED: guanine nucleotide-binding protein subunit beta-like protein [Daucus carota subsp. sativus] KZM88305.1 hypothetical protein DCAR_025380 [Daucus carota subsp. sativus] Length = 329 Score = 67.0 bits (162), Expect = 1e-10 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = +3 Query: 258 MAESLTLKGTLRAHTDWVTAIATPIDNSDMIV 353 MAESLTLKGTLRAHTDWVTAIATPIDNSDMIV Sbjct: 1 MAESLTLKGTLRAHTDWVTAIATPIDNSDMIV 32 >AAN86757.1 G-protein beta-subunit/auxin-regulated protein, partial [Nicotiana tabacum] Length = 64 Score = 59.3 bits (142), Expect = 1e-09 Identities = 26/30 (86%), Positives = 29/30 (96%) Frame = +3 Query: 264 ESLTLKGTLRAHTDWVTAIATPIDNSDMIV 353 ESL L+GT+RAHTDWVTAIATP+DNSDMIV Sbjct: 4 ESLVLRGTMRAHTDWVTAIATPVDNSDMIV 33 >XP_019240559.1 PREDICTED: guanine nucleotide-binding protein subunit beta-like protein [Nicotiana attenuata] OIT20167.1 guanine nucleotide-binding protein subunit beta-like protein [Nicotiana attenuata] Length = 325 Score = 62.8 bits (151), Expect = 3e-09 Identities = 29/32 (90%), Positives = 31/32 (96%) Frame = +3 Query: 258 MAESLTLKGTLRAHTDWVTAIATPIDNSDMIV 353 M+ESL L+GTLRAHTDWVTAIATPIDNSDMIV Sbjct: 1 MSESLVLRGTLRAHTDWVTAIATPIDNSDMIV 32 >XP_016457872.1 PREDICTED: guanine nucleotide-binding protein subunit beta-like protein [Nicotiana tabacum] Length = 325 Score = 62.0 bits (149), Expect = 6e-09 Identities = 28/32 (87%), Positives = 31/32 (96%) Frame = +3 Query: 258 MAESLTLKGTLRAHTDWVTAIATPIDNSDMIV 353 M+ESL L+GT+RAHTDWVTAIATPIDNSDMIV Sbjct: 1 MSESLVLRGTMRAHTDWVTAIATPIDNSDMIV 32 >XP_009780116.1 PREDICTED: guanine nucleotide-binding protein subunit beta-like protein [Nicotiana sylvestris] Length = 325 Score = 62.0 bits (149), Expect = 6e-09 Identities = 28/32 (87%), Positives = 31/32 (96%) Frame = +3 Query: 258 MAESLTLKGTLRAHTDWVTAIATPIDNSDMIV 353 M+ESL L+GT+RAHTDWVTAIATPIDNSDMIV Sbjct: 1 MSESLVLRGTMRAHTDWVTAIATPIDNSDMIV 32 >XP_009611065.1 PREDICTED: guanine nucleotide-binding protein subunit beta-like protein [Nicotiana tomentosiformis] Length = 325 Score = 62.0 bits (149), Expect = 6e-09 Identities = 28/32 (87%), Positives = 31/32 (96%) Frame = +3 Query: 258 MAESLTLKGTLRAHTDWVTAIATPIDNSDMIV 353 M+ESL L+GT+RAHTDWVTAIATPIDNSDMIV Sbjct: 1 MSESLVLRGTMRAHTDWVTAIATPIDNSDMIV 32 >KVI07882.1 G-protein beta WD-40 repeat-containing protein [Cynara cardunculus var. scolymus] Length = 329 Score = 62.0 bits (149), Expect = 6e-09 Identities = 28/32 (87%), Positives = 31/32 (96%) Frame = +3 Query: 258 MAESLTLKGTLRAHTDWVTAIATPIDNSDMIV 353 MA+SL L+GT+RAHTDWVTAIATPIDNSDMIV Sbjct: 1 MADSLVLRGTMRAHTDWVTAIATPIDNSDMIV 32 >KVI04616.1 G-protein beta WD-40 repeat-containing protein [Cynara cardunculus var. scolymus] Length = 329 Score = 62.0 bits (149), Expect = 6e-09 Identities = 28/32 (87%), Positives = 31/32 (96%) Frame = +3 Query: 258 MAESLTLKGTLRAHTDWVTAIATPIDNSDMIV 353 MA+SL L+GT+RAHTDWVTAIATPIDNSDMIV Sbjct: 1 MADSLVLRGTMRAHTDWVTAIATPIDNSDMIV 32 >XP_016555915.1 PREDICTED: guanine nucleotide-binding protein subunit beta-like protein [Capsicum annuum] Length = 329 Score = 59.7 bits (143), Expect = 4e-08 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = +3 Query: 264 ESLTLKGTLRAHTDWVTAIATPIDNSDMIV 353 ESL L+GT+RAHTDWVTAIATPIDNSDMIV Sbjct: 4 ESLVLRGTMRAHTDWVTAIATPIDNSDMIV 33 >XP_019239450.1 PREDICTED: guanine nucleotide-binding protein subunit beta-like protein [Nicotiana attenuata] OIT21011.1 guanine nucleotide-binding protein subunit beta-like protein [Nicotiana attenuata] Length = 326 Score = 59.3 bits (142), Expect = 6e-08 Identities = 26/30 (86%), Positives = 29/30 (96%) Frame = +3 Query: 264 ESLTLKGTLRAHTDWVTAIATPIDNSDMIV 353 ESL L+GT+RAHTDWVTAIATP+DNSDMIV Sbjct: 4 ESLVLRGTMRAHTDWVTAIATPVDNSDMIV 33 >P93340.1 RecName: Full=Guanine nucleotide-binding protein subunit beta-like protein CAA70705.1 G protein beta subunit [Nicotiana plumbaginifolia] Length = 326 Score = 59.3 bits (142), Expect = 6e-08 Identities = 26/30 (86%), Positives = 29/30 (96%) Frame = +3 Query: 264 ESLTLKGTLRAHTDWVTAIATPIDNSDMIV 353 ESL L+GT+RAHTDWVTAIATP+DNSDMIV Sbjct: 4 ESLVLRGTMRAHTDWVTAIATPVDNSDMIV 33 >XP_009778426.1 PREDICTED: guanine nucleotide-binding protein subunit beta-like protein [Nicotiana sylvestris] XP_016447181.1 PREDICTED: guanine nucleotide-binding protein subunit beta-like protein [Nicotiana tabacum] Length = 326 Score = 59.3 bits (142), Expect = 6e-08 Identities = 26/30 (86%), Positives = 29/30 (96%) Frame = +3 Query: 264 ESLTLKGTLRAHTDWVTAIATPIDNSDMIV 353 ESL L+GT+RAHTDWVTAIATP+DNSDMIV Sbjct: 4 ESLVLRGTMRAHTDWVTAIATPVDNSDMIV 33 >XP_009624187.1 PREDICTED: guanine nucleotide-binding protein subunit beta-like protein [Nicotiana tomentosiformis] Length = 326 Score = 59.3 bits (142), Expect = 6e-08 Identities = 26/30 (86%), Positives = 29/30 (96%) Frame = +3 Query: 264 ESLTLKGTLRAHTDWVTAIATPIDNSDMIV 353 ESL L+GT+RAHTDWVTAIATP+DNSDMIV Sbjct: 4 ESLVLRGTMRAHTDWVTAIATPVDNSDMIV 33 >ACR77528.1 heterotrimeric G protein beta 1 subunit [Nicotiana benthamiana] Length = 326 Score = 59.3 bits (142), Expect = 6e-08 Identities = 26/30 (86%), Positives = 29/30 (96%) Frame = +3 Query: 264 ESLTLKGTLRAHTDWVTAIATPIDNSDMIV 353 ESL L+GT+RAHTDWVTAIATP+DNSDMIV Sbjct: 4 ESLVLRGTMRAHTDWVTAIATPVDNSDMIV 33 >EYU40229.1 hypothetical protein MIMGU_mgv1a008949mg [Erythranthe guttata] Length = 357 Score = 59.3 bits (142), Expect = 6e-08 Identities = 33/53 (62%), Positives = 38/53 (71%), Gaps = 4/53 (7%) Frame = +3 Query: 207 P*LLSFSFLS----HPQKTLEMAESLTLKGTLRAHTDWVTAIATPIDNSDMIV 353 P L+SFS + H Q + E L L+GT+RAHTDWVTAIATPIDNSDMIV Sbjct: 10 PPLISFSPSAAAAVHNQSAMAQ-EQLVLRGTMRAHTDWVTAIATPIDNSDMIV 61 >XP_011084467.1 PREDICTED: LOW QUALITY PROTEIN: guanine nucleotide-binding protein subunit beta-like protein [Sesamum indicum] Length = 318 Score = 58.9 bits (141), Expect = 8e-08 Identities = 27/30 (90%), Positives = 28/30 (93%) Frame = +3 Query: 264 ESLTLKGTLRAHTDWVTAIATPIDNSDMIV 353 E L L+GTLRAHTDWVTAIATPIDNSDMIV Sbjct: 4 EQLVLRGTLRAHTDWVTAIATPIDNSDMIV 33 >JAU54828.1 Guanine nucleotide-binding protein subunit beta-like protein, partial [Noccaea caerulescens] Length = 354 Score = 58.9 bits (141), Expect = 8e-08 Identities = 33/57 (57%), Positives = 38/57 (66%), Gaps = 12/57 (21%) Frame = +3 Query: 219 SFSFLSHPQKTLE------------MAESLTLKGTLRAHTDWVTAIATPIDNSDMIV 353 +FSFLS P + E MAE L LKGT+RAHTD VTAIATPIDN+D+IV Sbjct: 2 AFSFLSPPPRDSENPSVRSLLQATTMAERLVLKGTMRAHTDMVTAIATPIDNADIIV 58 >XP_004252271.1 PREDICTED: guanine nucleotide-binding protein subunit beta-like protein isoform X2 [Solanum lycopersicum] Length = 301 Score = 58.5 bits (140), Expect = 1e-07 Identities = 26/30 (86%), Positives = 29/30 (96%) Frame = +3 Query: 264 ESLTLKGTLRAHTDWVTAIATPIDNSDMIV 353 ESL L+GT++AHTDWVTAIATPIDNSDMIV Sbjct: 4 ESLVLRGTMKAHTDWVTAIATPIDNSDMIV 33 >NP_001233881.2 ArcA2 protein [Solanum lycopersicum] XP_015070006.1 PREDICTED: guanine nucleotide-binding protein subunit beta-like protein [Solanum pennellii] Length = 326 Score = 58.5 bits (140), Expect = 1e-07 Identities = 26/30 (86%), Positives = 29/30 (96%) Frame = +3 Query: 264 ESLTLKGTLRAHTDWVTAIATPIDNSDMIV 353 ESL L+GT++AHTDWVTAIATPIDNSDMIV Sbjct: 4 ESLVLRGTMKAHTDWVTAIATPIDNSDMIV 33 >NP_001233876.2 ArcA1 protein [Solanum lycopersicum] XP_015079379.1 PREDICTED: guanine nucleotide-binding protein subunit beta-like protein [Solanum pennellii] Length = 326 Score = 58.5 bits (140), Expect = 1e-07 Identities = 26/30 (86%), Positives = 29/30 (96%) Frame = +3 Query: 264 ESLTLKGTLRAHTDWVTAIATPIDNSDMIV 353 ESL L+GT++AHTDWVTAIATPIDNSDMIV Sbjct: 4 ESLVLRGTMKAHTDWVTAIATPIDNSDMIV 33