BLASTX nr result
ID: Angelica27_contig00024719
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00024719 (214 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017237695.1 PREDICTED: wee1-like protein kinase [Daucus carot... 65 1e-10 >XP_017237695.1 PREDICTED: wee1-like protein kinase [Daucus carota subsp. sativus] XP_017237696.1 PREDICTED: wee1-like protein kinase [Daucus carota subsp. sativus] KZN03643.1 hypothetical protein DCAR_012399 [Daucus carota subsp. sativus] Length = 506 Score = 65.1 bits (157), Expect = 1e-10 Identities = 37/62 (59%), Positives = 40/62 (64%) Frame = +2 Query: 29 KWSKLGLNKGSLAAHLSMQLGQVSLFFRNQQSPTXXXXXXXXXXXXIDAEAEGLKGGEVE 208 K +K G NKGSLAAHLSMQLGQVSL RNQQSP ID EAEG + G VE Sbjct: 20 KKTKSGENKGSLAAHLSMQLGQVSLMVRNQQSPAFGLANSSRFQAMIDEEAEGGERGGVE 79 Query: 209 ME 214 +E Sbjct: 80 VE 81