BLASTX nr result
ID: Angelica27_contig00024567
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00024567 (317 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017250071.1 PREDICTED: glutathione S-transferase T3-like [Dau... 55 1e-06 KZM95200.1 hypothetical protein DCAR_018442 [Daucus carota subsp... 55 1e-06 >XP_017250071.1 PREDICTED: glutathione S-transferase T3-like [Daucus carota subsp. sativus] Length = 344 Score = 55.1 bits (131), Expect = 1e-06 Identities = 27/35 (77%), Positives = 30/35 (85%) Frame = -2 Query: 142 VMSTDTCKMGEIENEYYSLLKTSIIKKRRVTGFQL 38 +MST+T M EIE EYYSLLK+SIIKKRR TGFQL Sbjct: 310 IMSTNTTNMDEIEAEYYSLLKSSIIKKRRSTGFQL 344 >KZM95200.1 hypothetical protein DCAR_018442 [Daucus carota subsp. sativus] Length = 999 Score = 55.1 bits (131), Expect = 1e-06 Identities = 27/35 (77%), Positives = 30/35 (85%) Frame = -2 Query: 142 VMSTDTCKMGEIENEYYSLLKTSIIKKRRVTGFQL 38 +MST+T M EIE EYYSLLK+SIIKKRR TGFQL Sbjct: 965 IMSTNTTNMDEIEAEYYSLLKSSIIKKRRSTGFQL 999