BLASTX nr result
ID: Angelica27_contig00024396
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00024396 (294 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017219565.1 PREDICTED: probable nucleoredoxin 1 isoform X2 [D... 61 1e-08 XP_017219564.1 PREDICTED: probable nucleoredoxin 1 isoform X1 [D... 61 1e-08 >XP_017219565.1 PREDICTED: probable nucleoredoxin 1 isoform X2 [Daucus carota subsp. sativus] Length = 622 Score = 60.8 bits (146), Expect = 1e-08 Identities = 25/34 (73%), Positives = 28/34 (82%) Frame = +2 Query: 2 CWGYWDTLYQGLLKDSKRQINFPSGDLLCCVYFY 103 CWGYWDTLY+GLL DS +Q NF +GDLL CVY Y Sbjct: 585 CWGYWDTLYKGLLIDSVKQNNFTAGDLLFCVYHY 618 >XP_017219564.1 PREDICTED: probable nucleoredoxin 1 isoform X1 [Daucus carota subsp. sativus] Length = 624 Score = 60.8 bits (146), Expect = 1e-08 Identities = 25/34 (73%), Positives = 28/34 (82%) Frame = +2 Query: 2 CWGYWDTLYQGLLKDSKRQINFPSGDLLCCVYFY 103 CWGYWDTLY+GLL DS +Q NF +GDLL CVY Y Sbjct: 587 CWGYWDTLYKGLLIDSVKQNNFTAGDLLFCVYHY 620