BLASTX nr result
ID: Angelica27_contig00024053
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00024053 (329 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KZM93785.1 hypothetical protein DCAR_017030 [Daucus carota subsp... 72 2e-12 XP_017249907.1 PREDICTED: polygalacturonase inhibitor-like [Dauc... 72 2e-12 APZ89677.1 AFP protein [Daucus carota] 68 3e-11 XP_017249729.1 PREDICTED: polygalacturonase inhibitor-like [Dauc... 68 3e-11 AFW20019.1 antifreeze protein [Daucus carota] 68 3e-11 AAV66074.1 antifreeze protein [Daucus carota] 66 2e-10 JAU18022.1 Polygalacturonase inhibitor 1, partial [Noccaea caeru... 59 2e-09 JAU39213.1 Polygalacturonase inhibitor 1, partial [Noccaea caeru... 59 2e-09 JAU89671.1 Polygalacturonase inhibitor 1, partial [Noccaea caeru... 59 3e-09 XP_010057912.1 PREDICTED: polygalacturonase inhibitor [Eucalyptu... 63 3e-09 AFN53656.1 putative serine-threonine protein kinase [Linum usita... 62 7e-09 KQK08129.1 hypothetical protein BRADI_2g39830 [Brachypodium dist... 61 9e-09 XP_003569139.1 PREDICTED: polygalacturonase inhibitor-like [Brac... 61 9e-09 EMT31209.1 hypothetical protein F775_11410 [Aegilops tauschii] 61 1e-08 KYP43867.1 Polygalacturonase inhibitor, partial [Cajanus cajan] 57 1e-08 XP_018481550.1 PREDICTED: polygalacturonase inhibitor 2-like [Ra... 61 1e-08 EMS66324.1 Polygalacturonase inhibitor [Triticum urartu] 61 1e-08 XP_020160694.1 polygalacturonase inhibitor-like [Aegilops tausch... 61 1e-08 XP_006399163.1 hypothetical protein EUTSA_v10014071mg [Eutrema s... 60 2e-08 XP_010111407.1 Polygalacturonase inhibitor [Morus notabilis] EXC... 60 3e-08 >KZM93785.1 hypothetical protein DCAR_017030 [Daucus carota subsp. sativus] Length = 318 Score = 71.6 bits (174), Expect = 2e-12 Identities = 32/38 (84%), Positives = 33/38 (86%) Frame = +1 Query: 1 QLQTFNVSNNKLCGTIPTGANLERFDSTAYLNNTCLCG 114 QLQTFNVSNNKLCG IP NLERF +TAYLNNTCLCG Sbjct: 275 QLQTFNVSNNKLCGMIPAEGNLERFGNTAYLNNTCLCG 312 >XP_017249907.1 PREDICTED: polygalacturonase inhibitor-like [Daucus carota subsp. sativus] Length = 333 Score = 71.6 bits (174), Expect = 2e-12 Identities = 32/38 (84%), Positives = 33/38 (86%) Frame = +1 Query: 1 QLQTFNVSNNKLCGTIPTGANLERFDSTAYLNNTCLCG 114 QLQTFNVSNNKLCG IP NLERF +TAYLNNTCLCG Sbjct: 290 QLQTFNVSNNKLCGMIPAEGNLERFGNTAYLNNTCLCG 327 >APZ89677.1 AFP protein [Daucus carota] Length = 332 Score = 68.2 bits (165), Expect = 3e-11 Identities = 29/37 (78%), Positives = 33/37 (89%) Frame = +1 Query: 4 LQTFNVSNNKLCGTIPTGANLERFDSTAYLNNTCLCG 114 LQTFNVS+N LCG IPTG NL+RFD TAYL+N+CLCG Sbjct: 290 LQTFNVSDNNLCGKIPTGGNLQRFDRTAYLHNSCLCG 326 >XP_017249729.1 PREDICTED: polygalacturonase inhibitor-like [Daucus carota subsp. sativus] AAC62932.1 antifreeze protein [Daucus carota] CAB37347.1 antifreeze polypeptide [Daucus carota] KZM93784.1 hypothetical protein DCAR_017029 [Daucus carota subsp. sativus] Length = 332 Score = 68.2 bits (165), Expect = 3e-11 Identities = 29/37 (78%), Positives = 33/37 (89%) Frame = +1 Query: 4 LQTFNVSNNKLCGTIPTGANLERFDSTAYLNNTCLCG 114 LQTFNVS+N LCG IPTG NL+RFD TAYL+N+CLCG Sbjct: 290 LQTFNVSDNNLCGKIPTGGNLQRFDRTAYLHNSCLCG 326 >AFW20019.1 antifreeze protein [Daucus carota] Length = 332 Score = 68.2 bits (165), Expect = 3e-11 Identities = 29/37 (78%), Positives = 33/37 (89%) Frame = +1 Query: 4 LQTFNVSNNKLCGTIPTGANLERFDSTAYLNNTCLCG 114 LQTFNVS+N LCG IPTG NL+RFD TAYL+N+CLCG Sbjct: 290 LQTFNVSDNNLCGKIPTGGNLQRFDRTAYLHNSCLCG 326 >AAV66074.1 antifreeze protein [Daucus carota] Length = 332 Score = 65.9 bits (159), Expect = 2e-10 Identities = 28/37 (75%), Positives = 32/37 (86%) Frame = +1 Query: 4 LQTFNVSNNKLCGTIPTGANLERFDSTAYLNNTCLCG 114 LQTFNVS+N LCG IPTG NL+RFD TAYL ++CLCG Sbjct: 290 LQTFNVSDNNLCGKIPTGGNLQRFDRTAYLRDSCLCG 326 >JAU18022.1 Polygalacturonase inhibitor 1, partial [Noccaea caerulescens] Length = 91 Score = 59.3 bits (142), Expect = 2e-09 Identities = 25/37 (67%), Positives = 31/37 (83%) Frame = +1 Query: 4 LQTFNVSNNKLCGTIPTGANLERFDSTAYLNNTCLCG 114 LQ+FNVS N+LCG IP G +L+RFD+ AYL+N CLCG Sbjct: 54 LQSFNVSYNRLCGRIPKGGDLQRFDAYAYLHNKCLCG 90 >JAU39213.1 Polygalacturonase inhibitor 1, partial [Noccaea caerulescens] Length = 93 Score = 59.3 bits (142), Expect = 2e-09 Identities = 25/37 (67%), Positives = 31/37 (83%) Frame = +1 Query: 4 LQTFNVSNNKLCGTIPTGANLERFDSTAYLNNTCLCG 114 LQ+FNVS N+LCG IP G +L+RFD+ AYL+N CLCG Sbjct: 54 LQSFNVSYNRLCGRIPKGGDLQRFDAYAYLHNKCLCG 90 >JAU89671.1 Polygalacturonase inhibitor 1, partial [Noccaea caerulescens] Length = 97 Score = 59.3 bits (142), Expect = 3e-09 Identities = 25/37 (67%), Positives = 31/37 (83%) Frame = +1 Query: 4 LQTFNVSNNKLCGTIPTGANLERFDSTAYLNNTCLCG 114 LQ+FNVS N+LCG IP G +L+RFD+ AYL+N CLCG Sbjct: 54 LQSFNVSYNRLCGRIPKGGDLQRFDAYAYLHNKCLCG 90 >XP_010057912.1 PREDICTED: polygalacturonase inhibitor [Eucalyptus grandis] Length = 335 Score = 62.8 bits (151), Expect = 3e-09 Identities = 27/38 (71%), Positives = 30/38 (78%) Frame = +1 Query: 4 LQTFNVSNNKLCGTIPTGANLERFDSTAYLNNTCLCGT 117 LQ FNVS N+LCG IP G L+RFDSTAY +N CLCGT Sbjct: 292 LQIFNVSYNRLCGEIPVGGRLQRFDSTAYFHNRCLCGT 329 >AFN53656.1 putative serine-threonine protein kinase [Linum usitatissimum] Length = 334 Score = 61.6 bits (148), Expect = 7e-09 Identities = 26/39 (66%), Positives = 31/39 (79%) Frame = +1 Query: 1 QLQTFNVSNNKLCGTIPTGANLERFDSTAYLNNTCLCGT 117 +LQ FNVS N+LCG IPTG L+ FDSTAY +N CLCG+ Sbjct: 290 ELQLFNVSYNRLCGEIPTGGKLQSFDSTAYFHNRCLCGS 328 >KQK08129.1 hypothetical protein BRADI_2g39830 [Brachypodium distachyon] Length = 318 Score = 61.2 bits (147), Expect = 9e-09 Identities = 25/38 (65%), Positives = 31/38 (81%) Frame = +1 Query: 4 LQTFNVSNNKLCGTIPTGANLERFDSTAYLNNTCLCGT 117 LQ FNVS N+LCGT+PTG N+ +FD +YL+N CLCGT Sbjct: 268 LQQFNVSFNRLCGTVPTGGNMAKFDRYSYLHNKCLCGT 305 >XP_003569139.1 PREDICTED: polygalacturonase inhibitor-like [Brachypodium distachyon] Length = 336 Score = 61.2 bits (147), Expect = 9e-09 Identities = 25/38 (65%), Positives = 31/38 (81%) Frame = +1 Query: 4 LQTFNVSNNKLCGTIPTGANLERFDSTAYLNNTCLCGT 117 LQ FNVS N+LCGT+PTG N+ +FD +YL+N CLCGT Sbjct: 286 LQQFNVSFNRLCGTVPTGGNMAKFDRYSYLHNKCLCGT 323 >EMT31209.1 hypothetical protein F775_11410 [Aegilops tauschii] Length = 281 Score = 60.8 bits (146), Expect = 1e-08 Identities = 25/38 (65%), Positives = 30/38 (78%) Frame = +1 Query: 4 LQTFNVSNNKLCGTIPTGANLERFDSTAYLNNTCLCGT 117 LQ FNVS N+LCG +PTG N+ RFD +YL+N CLCGT Sbjct: 230 LQQFNVSFNRLCGAVPTGGNMSRFDRYSYLHNKCLCGT 267 >KYP43867.1 Polygalacturonase inhibitor, partial [Cajanus cajan] Length = 72 Score = 57.0 bits (136), Expect = 1e-08 Identities = 24/38 (63%), Positives = 29/38 (76%) Frame = +1 Query: 4 LQTFNVSNNKLCGTIPTGANLERFDSTAYLNNTCLCGT 117 LQ FNVS N+LCG IP G L+RFD +YL+N CLCG+ Sbjct: 22 LQQFNVSYNRLCGEIPQGGQLQRFDEYSYLHNKCLCGS 59 >XP_018481550.1 PREDICTED: polygalacturonase inhibitor 2-like [Raphanus sativus] Length = 333 Score = 60.8 bits (146), Expect = 1e-08 Identities = 26/37 (70%), Positives = 31/37 (83%) Frame = +1 Query: 4 LQTFNVSNNKLCGTIPTGANLERFDSTAYLNNTCLCG 114 LQTFNVS N+LCG IP G +L+RFD+ AYL+N CLCG Sbjct: 287 LQTFNVSYNRLCGRIPQGGDLQRFDAYAYLHNKCLCG 323 >EMS66324.1 Polygalacturonase inhibitor [Triticum urartu] Length = 336 Score = 60.8 bits (146), Expect = 1e-08 Identities = 25/38 (65%), Positives = 30/38 (78%) Frame = +1 Query: 4 LQTFNVSNNKLCGTIPTGANLERFDSTAYLNNTCLCGT 117 LQ FNVS N+LCG +PTG N+ RFD +YL+N CLCGT Sbjct: 285 LQQFNVSFNRLCGAVPTGGNMSRFDRYSYLHNKCLCGT 322 >XP_020160694.1 polygalacturonase inhibitor-like [Aegilops tauschii subsp. tauschii] Length = 337 Score = 60.8 bits (146), Expect = 1e-08 Identities = 25/38 (65%), Positives = 30/38 (78%) Frame = +1 Query: 4 LQTFNVSNNKLCGTIPTGANLERFDSTAYLNNTCLCGT 117 LQ FNVS N+LCG +PTG N+ RFD +YL+N CLCGT Sbjct: 286 LQQFNVSFNRLCGAVPTGGNMSRFDRYSYLHNKCLCGT 323 >XP_006399163.1 hypothetical protein EUTSA_v10014071mg [Eutrema salsugineum] ESQ40616.1 hypothetical protein EUTSA_v10014071mg [Eutrema salsugineum] Length = 334 Score = 60.5 bits (145), Expect = 2e-08 Identities = 26/37 (70%), Positives = 31/37 (83%) Frame = +1 Query: 4 LQTFNVSNNKLCGTIPTGANLERFDSTAYLNNTCLCG 114 LQ+FNVS N+LCG IP G +L+RFDS AYL+N CLCG Sbjct: 291 LQSFNVSYNRLCGRIPKGGDLQRFDSYAYLHNKCLCG 327 >XP_010111407.1 Polygalacturonase inhibitor [Morus notabilis] EXC30885.1 Polygalacturonase inhibitor [Morus notabilis] Length = 333 Score = 59.7 bits (143), Expect = 3e-08 Identities = 25/39 (64%), Positives = 30/39 (76%) Frame = +1 Query: 1 QLQTFNVSNNKLCGTIPTGANLERFDSTAYLNNTCLCGT 117 +L FNVS N+LCG IP G NL+RFD TAY +N CLCG+ Sbjct: 285 KLNLFNVSYNRLCGKIPVGGNLQRFDYTAYFHNRCLCGS 323