BLASTX nr result
ID: Angelica27_contig00023935
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00023935 (226 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value OMO64086.1 Ribosomal protein S27a [Corchorus capsularis] 114 6e-32 OMO78278.1 Ribosomal protein S27a [Corchorus capsularis] 114 2e-31 XP_008362581.1 PREDICTED: ubiquitin-40S ribosomal protein S27a-l... 114 2e-31 XP_010248517.1 PREDICTED: ubiquitin-40S ribosomal protein S27a [... 115 2e-31 ABR16172.1 unknown [Picea sitchensis] ABR16495.1 unknown [Picea ... 115 2e-31 XP_006424488.1 hypothetical protein CICLE_v10029476mg [Citrus cl... 115 2e-31 XP_012834695.1 PREDICTED: ubiquitin-40S ribosomal protein S27a [... 115 3e-31 XP_015957110.1 PREDICTED: ubiquitin-40S ribosomal protein S27a [... 115 4e-31 XP_015891823.1 PREDICTED: ubiquitin-40S ribosomal protein S27a-l... 115 4e-31 XP_003634320.1 PREDICTED: ubiquitin-40S ribosomal protein S27a [... 115 4e-31 XP_014497797.1 PREDICTED: ubiquitin-40S ribosomal protein S27a-l... 114 5e-31 XP_003629895.2 ubiquitin-40S ribosomal S27a-like protein [Medica... 114 5e-31 XP_004504241.1 PREDICTED: ubiquitin-40S ribosomal protein S27a [... 114 5e-31 XP_004489824.1 PREDICTED: ubiquitin-40S ribosomal protein S27a [... 114 5e-31 AFK49579.1 unknown [Lotus japonicus] 114 5e-31 XP_003613203.1 ubiquitin-40S ribosomal S27a-like protein [Medica... 114 5e-31 XP_016551560.1 PREDICTED: ubiquitin-40S ribosomal protein S27a [... 114 6e-31 CAN80663.1 hypothetical protein VITISV_036195 [Vitis vinifera] 114 6e-31 XP_002279878.1 PREDICTED: ubiquitin-40S ribosomal protein S27a [... 114 6e-31 XP_011040332.1 PREDICTED: ubiquitin-40S ribosomal protein S27a-l... 114 6e-31 >OMO64086.1 Ribosomal protein S27a [Corchorus capsularis] Length = 81 Score = 114 bits (286), Expect = 6e-32 Identities = 51/53 (96%), Positives = 51/53 (96%) Frame = +2 Query: 29 LAVLQFYKVDDSGKVQRLRKECPNQECGAGTFMANHFDRHYCGKCGLTYVYAK 187 LAVLQFYKVDDSGKVQRLRKECPN ECGAGTFMANHFDRHYCGKCGLTYVY K Sbjct: 25 LAVLQFYKVDDSGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYQK 77 >OMO78278.1 Ribosomal protein S27a [Corchorus capsularis] Length = 113 Score = 114 bits (286), Expect = 2e-31 Identities = 51/53 (96%), Positives = 51/53 (96%) Frame = +2 Query: 29 LAVLQFYKVDDSGKVQRLRKECPNQECGAGTFMANHFDRHYCGKCGLTYVYAK 187 LAVLQFYKVDDSGKVQRLRKECPN ECGAGTFMANHFDRHYCGKCGLTYVY K Sbjct: 57 LAVLQFYKVDDSGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYQK 109 >XP_008362581.1 PREDICTED: ubiquitin-40S ribosomal protein S27a-like, partial [Malus domestica] Length = 115 Score = 114 bits (286), Expect = 2e-31 Identities = 51/53 (96%), Positives = 51/53 (96%) Frame = +2 Query: 29 LAVLQFYKVDDSGKVQRLRKECPNQECGAGTFMANHFDRHYCGKCGLTYVYAK 187 LAVLQFYKVDDSGKVQRLRKECPN ECGAGTFMANHFDRHYCGKCGLTYVY K Sbjct: 59 LAVLQFYKVDDSGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYQK 111 >XP_010248517.1 PREDICTED: ubiquitin-40S ribosomal protein S27a [Nelumbo nucifera] Length = 156 Score = 115 bits (289), Expect = 2e-31 Identities = 51/53 (96%), Positives = 52/53 (98%) Frame = +2 Query: 29 LAVLQFYKVDDSGKVQRLRKECPNQECGAGTFMANHFDRHYCGKCGLTYVYAK 187 LA+LQFYKVDDSGKVQRLRKECPNQECGAGTFMANHFDRHYCGKCGLTYVY K Sbjct: 100 LALLQFYKVDDSGKVQRLRKECPNQECGAGTFMANHFDRHYCGKCGLTYVYQK 152 >ABR16172.1 unknown [Picea sitchensis] ABR16495.1 unknown [Picea sitchensis] ABR16621.1 unknown [Picea sitchensis] Length = 156 Score = 115 bits (289), Expect = 2e-31 Identities = 51/56 (91%), Positives = 54/56 (96%) Frame = +2 Query: 29 LAVLQFYKVDDSGKVQRLRKECPNQECGAGTFMANHFDRHYCGKCGLTYVYAKDAS 196 LAVLQ+YKVDDSGKVQRLRKECPNQ+CGAGTFMANHFDRHYCGKCGLTYVY K A+ Sbjct: 100 LAVLQYYKVDDSGKVQRLRKECPNQDCGAGTFMANHFDRHYCGKCGLTYVYQKAAA 155 >XP_006424488.1 hypothetical protein CICLE_v10029476mg [Citrus clementina] ESR37728.1 hypothetical protein CICLE_v10029476mg [Citrus clementina] Length = 156 Score = 115 bits (289), Expect = 2e-31 Identities = 52/57 (91%), Positives = 53/57 (92%) Frame = +2 Query: 29 LAVLQFYKVDDSGKVQRLRKECPNQECGAGTFMANHFDRHYCGKCGLTYVYAKDASN 199 LAVLQFYKVDDSGKVQRLRKECPN ECGAGTFMANHFDRHYCGKCGLTYVY K S+ Sbjct: 100 LAVLQFYKVDDSGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYQKAGSD 156 >XP_012834695.1 PREDICTED: ubiquitin-40S ribosomal protein S27a [Erythranthe guttata] EYU46866.1 hypothetical protein MIMGU_mgv1a015483mg [Erythranthe guttata] Length = 156 Score = 115 bits (288), Expect = 3e-31 Identities = 50/57 (87%), Positives = 54/57 (94%) Frame = +2 Query: 29 LAVLQFYKVDDSGKVQRLRKECPNQECGAGTFMANHFDRHYCGKCGLTYVYAKDASN 199 L+VLQ+YK+DDSGKVQRLRKECPN ECGAGTFMANHFDRHYCGKCGLTYVYAK A + Sbjct: 100 LSVLQYYKIDDSGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYAKTAGD 156 >XP_015957110.1 PREDICTED: ubiquitin-40S ribosomal protein S27a [Arachis duranensis] XP_015962568.1 PREDICTED: ubiquitin-40S ribosomal protein S27a [Arachis duranensis] XP_015965054.1 PREDICTED: ubiquitin-40S ribosomal protein S27a [Arachis duranensis] XP_016190236.1 PREDICTED: ubiquitin-40S ribosomal protein S27a [Arachis ipaensis] XP_016194480.1 PREDICTED: ubiquitin-40S ribosomal protein S27a [Arachis ipaensis] ABI84265.1 ubiquitin/ribosomal protein S27a [Arachis hypogaea] Length = 155 Score = 115 bits (287), Expect = 4e-31 Identities = 50/56 (89%), Positives = 53/56 (94%) Frame = +2 Query: 29 LAVLQFYKVDDSGKVQRLRKECPNQECGAGTFMANHFDRHYCGKCGLTYVYAKDAS 196 LA+LQFYK+DDSGKVQRLRKECPN ECGAGTFMANHFDRHYCGKCGLTYVY K A+ Sbjct: 100 LAILQFYKIDDSGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYQKAAA 155 >XP_015891823.1 PREDICTED: ubiquitin-40S ribosomal protein S27a-like [Ziziphus jujuba] Length = 156 Score = 115 bits (287), Expect = 4e-31 Identities = 51/57 (89%), Positives = 52/57 (91%) Frame = +2 Query: 29 LAVLQFYKVDDSGKVQRLRKECPNQECGAGTFMANHFDRHYCGKCGLTYVYAKDASN 199 LAVLQFYKVDDSGKVQRLRKECPN ECGAGTFMANHFDRHYCGKCGLTYVY K + Sbjct: 100 LAVLQFYKVDDSGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYQKSGGD 156 >XP_003634320.1 PREDICTED: ubiquitin-40S ribosomal protein S27a [Vitis vinifera] XP_018854928.1 PREDICTED: ubiquitin-40S ribosomal protein S27a-like [Juglans regia] XP_018805239.1 PREDICTED: ubiquitin-40S ribosomal protein S27a-like [Juglans regia] XP_018815087.1 PREDICTED: ubiquitin-40S ribosomal protein S27a-like [Juglans regia] CAN75420.1 hypothetical protein VITISV_037877 [Vitis vinifera] Length = 156 Score = 115 bits (287), Expect = 4e-31 Identities = 51/53 (96%), Positives = 51/53 (96%) Frame = +2 Query: 29 LAVLQFYKVDDSGKVQRLRKECPNQECGAGTFMANHFDRHYCGKCGLTYVYAK 187 LAVLQFYKVDDSGKVQRLRKECPN ECGAGTFMANHFDRHYCGKCGLTYVY K Sbjct: 100 LAVLQFYKVDDSGKVQRLRKECPNSECGAGTFMANHFDRHYCGKCGLTYVYQK 152 >XP_014497797.1 PREDICTED: ubiquitin-40S ribosomal protein S27a-like [Vigna radiata var. radiata] XP_017418784.1 PREDICTED: ubiquitin-40S ribosomal protein S27a-like [Vigna angularis] XP_017418785.1 PREDICTED: ubiquitin-40S ribosomal protein S27a-like [Vigna angularis] Length = 155 Score = 114 bits (286), Expect = 5e-31 Identities = 51/53 (96%), Positives = 51/53 (96%) Frame = +2 Query: 29 LAVLQFYKVDDSGKVQRLRKECPNQECGAGTFMANHFDRHYCGKCGLTYVYAK 187 LAVLQFYKVDDSGKVQRLRKECPN ECGAGTFMANHFDRHYCGKCGLTYVY K Sbjct: 100 LAVLQFYKVDDSGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYQK 152 >XP_003629895.2 ubiquitin-40S ribosomal S27a-like protein [Medicago truncatula] ACJ83917.1 unknown [Medicago truncatula] ACJ86209.1 unknown [Medicago truncatula] AET04371.2 ubiquitin-40S ribosomal S27a-like protein [Medicago truncatula] Length = 155 Score = 114 bits (286), Expect = 5e-31 Identities = 51/53 (96%), Positives = 51/53 (96%) Frame = +2 Query: 29 LAVLQFYKVDDSGKVQRLRKECPNQECGAGTFMANHFDRHYCGKCGLTYVYAK 187 LAVLQFYKVDDSGKVQRLRKECPN ECGAGTFMANHFDRHYCGKCGLTYVY K Sbjct: 100 LAVLQFYKVDDSGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYQK 152 >XP_004504241.1 PREDICTED: ubiquitin-40S ribosomal protein S27a [Cicer arietinum] Length = 155 Score = 114 bits (286), Expect = 5e-31 Identities = 51/53 (96%), Positives = 51/53 (96%) Frame = +2 Query: 29 LAVLQFYKVDDSGKVQRLRKECPNQECGAGTFMANHFDRHYCGKCGLTYVYAK 187 LAVLQFYKVDDSGKVQRLRKECPN ECGAGTFMANHFDRHYCGKCGLTYVY K Sbjct: 100 LAVLQFYKVDDSGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYQK 152 >XP_004489824.1 PREDICTED: ubiquitin-40S ribosomal protein S27a [Cicer arietinum] Length = 155 Score = 114 bits (286), Expect = 5e-31 Identities = 51/53 (96%), Positives = 51/53 (96%) Frame = +2 Query: 29 LAVLQFYKVDDSGKVQRLRKECPNQECGAGTFMANHFDRHYCGKCGLTYVYAK 187 LAVLQFYKVDDSGKVQRLRKECPN ECGAGTFMANHFDRHYCGKCGLTYVY K Sbjct: 100 LAVLQFYKVDDSGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYQK 152 >AFK49579.1 unknown [Lotus japonicus] Length = 155 Score = 114 bits (286), Expect = 5e-31 Identities = 51/53 (96%), Positives = 51/53 (96%) Frame = +2 Query: 29 LAVLQFYKVDDSGKVQRLRKECPNQECGAGTFMANHFDRHYCGKCGLTYVYAK 187 LAVLQFYKVDDSGKVQRLRKECPN ECGAGTFMANHFDRHYCGKCGLTYVY K Sbjct: 100 LAVLQFYKVDDSGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYQK 152 >XP_003613203.1 ubiquitin-40S ribosomal S27a-like protein [Medicago truncatula] AES96161.1 ubiquitin-40S ribosomal S27a-like protein [Medicago truncatula] Length = 155 Score = 114 bits (286), Expect = 5e-31 Identities = 51/53 (96%), Positives = 51/53 (96%) Frame = +2 Query: 29 LAVLQFYKVDDSGKVQRLRKECPNQECGAGTFMANHFDRHYCGKCGLTYVYAK 187 LAVLQFYKVDDSGKVQRLRKECPN ECGAGTFMANHFDRHYCGKCGLTYVY K Sbjct: 100 LAVLQFYKVDDSGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYQK 152 >XP_016551560.1 PREDICTED: ubiquitin-40S ribosomal protein S27a [Capsicum annuum] XP_016551576.1 PREDICTED: ubiquitin-40S ribosomal protein S27a [Capsicum annuum] Length = 156 Score = 114 bits (286), Expect = 6e-31 Identities = 51/53 (96%), Positives = 51/53 (96%) Frame = +2 Query: 29 LAVLQFYKVDDSGKVQRLRKECPNQECGAGTFMANHFDRHYCGKCGLTYVYAK 187 LAVLQFYKVDDSGKVQRLRKECPN ECGAGTFMANHFDRHYCGKCGLTYVY K Sbjct: 100 LAVLQFYKVDDSGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYQK 152 >CAN80663.1 hypothetical protein VITISV_036195 [Vitis vinifera] Length = 156 Score = 114 bits (286), Expect = 6e-31 Identities = 51/53 (96%), Positives = 51/53 (96%) Frame = +2 Query: 29 LAVLQFYKVDDSGKVQRLRKECPNQECGAGTFMANHFDRHYCGKCGLTYVYAK 187 LAVLQFYKVDDSGKVQRLRKECPN ECGAGTFMANHFDRHYCGKCGLTYVY K Sbjct: 100 LAVLQFYKVDDSGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYQK 152 >XP_002279878.1 PREDICTED: ubiquitin-40S ribosomal protein S27a [Vitis vinifera] XP_012082969.1 PREDICTED: ubiquitin-40S ribosomal protein S27a [Jatropha curcas] CAN71283.1 hypothetical protein VITISV_027093 [Vitis vinifera] CAN70884.1 hypothetical protein VITISV_029192 [Vitis vinifera] KDP28317.1 hypothetical protein JCGZ_14088 [Jatropha curcas] Length = 156 Score = 114 bits (286), Expect = 6e-31 Identities = 51/53 (96%), Positives = 51/53 (96%) Frame = +2 Query: 29 LAVLQFYKVDDSGKVQRLRKECPNQECGAGTFMANHFDRHYCGKCGLTYVYAK 187 LAVLQFYKVDDSGKVQRLRKECPN ECGAGTFMANHFDRHYCGKCGLTYVY K Sbjct: 100 LAVLQFYKVDDSGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYQK 152 >XP_011040332.1 PREDICTED: ubiquitin-40S ribosomal protein S27a-like [Populus euphratica] Length = 156 Score = 114 bits (286), Expect = 6e-31 Identities = 51/53 (96%), Positives = 51/53 (96%) Frame = +2 Query: 29 LAVLQFYKVDDSGKVQRLRKECPNQECGAGTFMANHFDRHYCGKCGLTYVYAK 187 LAVLQFYKVDDSGKVQRLRKECPN ECGAGTFMANHFDRHYCGKCGLTYVY K Sbjct: 100 LAVLQFYKVDDSGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYQK 152