BLASTX nr result
ID: Angelica27_contig00023489
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00023489 (267 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value JAT45782.1 36. proline-rich protein, partial [Anthurium amnicola] 65 9e-12 GAU50643.1 hypothetical protein TSUD_184350 [Trifolium subterran... 66 2e-11 KVI11686.1 Bifunctional inhibitor/plant lipid transfer protein/s... 66 2e-11 XP_019446704.1 PREDICTED: 36.4 kDa proline-rich protein-like [Lu... 66 2e-11 XP_011002408.1 PREDICTED: 36.4 kDa proline-rich protein isoform ... 65 2e-11 JAU09762.1 36.4 kDa proline-rich protein, partial [Noccaea caeru... 64 2e-11 XP_014506520.1 PREDICTED: 36.4 kDa proline-rich protein-like [Vi... 65 2e-11 XP_017428339.1 PREDICTED: 36.4 kDa proline-rich protein-like [Vi... 65 3e-11 XP_011002404.1 PREDICTED: 36.4 kDa proline-rich protein isoform ... 65 3e-11 WP_071414470.1 hypothetical protein [Acinetobacter baumannii] OI... 65 3e-11 JAU55343.1 36.4 kDa proline-rich protein, partial [Noccaea caeru... 64 4e-11 ABK95045.1 unknown [Populus trichocarpa] 65 4e-11 XP_010436582.1 PREDICTED: 36.4 kDa proline-rich protein-like, pa... 66 4e-11 XP_006380877.1 hypothetical protein POPTR_0006s01020g [Populus t... 65 4e-11 XP_006855688.1 PREDICTED: 36.4 kDa proline-rich protein [Amborel... 66 5e-11 JAT44226.1 36. proline-rich protein [Anthurium amnicola] 65 5e-11 XP_006286225.1 hypothetical protein CARUB_v10007792mg [Capsella ... 66 5e-11 XP_003525816.1 PREDICTED: 36.4 kDa proline-rich protein-like [Gl... 65 6e-11 XP_004516835.2 PREDICTED: 36.4 kDa proline-rich protein-like [Ci... 64 6e-11 XP_011002407.1 PREDICTED: 36.4 kDa proline-rich protein isoform ... 64 8e-11 >JAT45782.1 36. proline-rich protein, partial [Anthurium amnicola] Length = 122 Score = 65.5 bits (158), Expect = 9e-12 Identities = 27/39 (69%), Positives = 34/39 (87%) Frame = +3 Query: 3 ALCLCTVIKANLLNLDIYVPLALELLASCQKTPPKGFTC 119 A+CLCT IK LLNLDI++P+AL+LLA+C KTPP G+TC Sbjct: 82 AVCLCTTIKLKLLNLDIFIPIALKLLATCGKTPPPGYTC 120 >GAU50643.1 hypothetical protein TSUD_184350 [Trifolium subterraneum] Length = 190 Score = 66.2 bits (160), Expect = 2e-11 Identities = 27/40 (67%), Positives = 36/40 (90%) Frame = +3 Query: 3 ALCLCTVIKANLLNLDIYVPLALELLASCQKTPPKGFTCP 122 A+CLCTVI+A +LNL+IY+PLAL++LA+C KTPP+ F CP Sbjct: 149 AICLCTVIRAKVLNLNIYLPLALQVLATCGKTPPRDFVCP 188 >KVI11686.1 Bifunctional inhibitor/plant lipid transfer protein/seed storage helical domain-containing protein [Cynara cardunculus var. scolymus] Length = 202 Score = 66.2 bits (160), Expect = 2e-11 Identities = 27/39 (69%), Positives = 35/39 (89%) Frame = +3 Query: 3 ALCLCTVIKANLLNLDIYVPLALELLASCQKTPPKGFTC 119 A+CLCT +K NLLNL+IY+P+ALELLA+C K+PP G+TC Sbjct: 162 AVCLCTTLKVNLLNLNIYLPIALELLATCGKSPPPGYTC 200 >XP_019446704.1 PREDICTED: 36.4 kDa proline-rich protein-like [Lupinus angustifolius] OIW09790.1 hypothetical protein TanjilG_32228 [Lupinus angustifolius] Length = 186 Score = 65.9 bits (159), Expect = 2e-11 Identities = 26/40 (65%), Positives = 35/40 (87%) Frame = +3 Query: 3 ALCLCTVIKANLLNLDIYVPLALELLASCQKTPPKGFTCP 122 A+CLCT+I+A LLNL+I++PLAL++L +C KTPP GF CP Sbjct: 145 AICLCTIIRAKLLNLNIFIPLALQVLITCGKTPPPGFVCP 184 >XP_011002408.1 PREDICTED: 36.4 kDa proline-rich protein isoform X4 [Populus euphratica] Length = 167 Score = 65.5 bits (158), Expect = 2e-11 Identities = 27/40 (67%), Positives = 33/40 (82%) Frame = +3 Query: 3 ALCLCTVIKANLLNLDIYVPLALELLASCQKTPPKGFTCP 122 ALCLCT IKA LLN+++ +P+ALELL C KTPP+GF CP Sbjct: 127 ALCLCTAIKAKLLNINLIIPIALELLVDCGKTPPEGFKCP 166 >JAU09762.1 36.4 kDa proline-rich protein, partial [Noccaea caerulescens] Length = 119 Score = 64.3 bits (155), Expect = 2e-11 Identities = 27/40 (67%), Positives = 32/40 (80%) Frame = +3 Query: 3 ALCLCTVIKANLLNLDIYVPLALELLASCQKTPPKGFTCP 122 A+CLCT IKA LLN+DI +P+ALE+L C KTPP GF CP Sbjct: 79 AVCLCTTIKAKLLNIDIILPIALEVLLDCGKTPPSGFKCP 118 >XP_014506520.1 PREDICTED: 36.4 kDa proline-rich protein-like [Vigna radiata var. radiata] Length = 171 Score = 65.5 bits (158), Expect = 2e-11 Identities = 27/40 (67%), Positives = 35/40 (87%) Frame = +3 Query: 3 ALCLCTVIKANLLNLDIYVPLALELLASCQKTPPKGFTCP 122 A+CLCTVI+A LLNL+I++PLAL++L +C KTPP GF CP Sbjct: 129 AICLCTVIRAKLLNLNIFLPLALQVLITCGKTPPPGFVCP 168 >XP_017428339.1 PREDICTED: 36.4 kDa proline-rich protein-like [Vigna angularis] BAT75866.1 hypothetical protein VIGAN_01379500 [Vigna angularis var. angularis] Length = 175 Score = 65.5 bits (158), Expect = 3e-11 Identities = 27/40 (67%), Positives = 35/40 (87%) Frame = +3 Query: 3 ALCLCTVIKANLLNLDIYVPLALELLASCQKTPPKGFTCP 122 A+CLCTVI+A LLNL+I++PLAL++L +C KTPP GF CP Sbjct: 133 AICLCTVIRAKLLNLNIFLPLALQVLITCGKTPPPGFVCP 172 >XP_011002404.1 PREDICTED: 36.4 kDa proline-rich protein isoform X2 [Populus euphratica] XP_011002405.1 PREDICTED: 36.4 kDa proline-rich protein isoform X2 [Populus euphratica] Length = 182 Score = 65.5 bits (158), Expect = 3e-11 Identities = 27/40 (67%), Positives = 33/40 (82%) Frame = +3 Query: 3 ALCLCTVIKANLLNLDIYVPLALELLASCQKTPPKGFTCP 122 ALCLCT IKA LLN+++ +P+ALELL C KTPP+GF CP Sbjct: 142 ALCLCTAIKAKLLNINLIIPIALELLVDCGKTPPEGFKCP 181 >WP_071414470.1 hypothetical protein [Acinetobacter baumannii] OIC64613.1 hypothetical protein A7L55_18580 [Acinetobacter baumannii] Length = 188 Score = 65.5 bits (158), Expect = 3e-11 Identities = 27/41 (65%), Positives = 36/41 (87%) Frame = +3 Query: 3 ALCLCTVIKANLLNLDIYVPLALELLASCQKTPPKGFTCPK 125 ALCLCT I+A +L+L++Y+PLALEL+ASC TPP+GF CP+ Sbjct: 146 ALCLCTTIRAKVLSLNVYLPLALELIASCGLTPPEGFKCPE 186 >JAU55343.1 36.4 kDa proline-rich protein, partial [Noccaea caerulescens] Length = 137 Score = 64.3 bits (155), Expect = 4e-11 Identities = 27/40 (67%), Positives = 32/40 (80%) Frame = +3 Query: 3 ALCLCTVIKANLLNLDIYVPLALELLASCQKTPPKGFTCP 122 A+CLCT IKA LLN+DI +P+ALE+L C KTPP GF CP Sbjct: 97 AVCLCTTIKAKLLNIDIILPIALEVLLDCGKTPPSGFKCP 136 >ABK95045.1 unknown [Populus trichocarpa] Length = 179 Score = 65.1 bits (157), Expect = 4e-11 Identities = 27/40 (67%), Positives = 34/40 (85%) Frame = +3 Query: 3 ALCLCTVIKANLLNLDIYVPLALELLASCQKTPPKGFTCP 122 A+CLCTVIKA LLN+++ +P+ALELL C KTPP+GF CP Sbjct: 139 AVCLCTVIKAKLLNINLILPIALELLVDCGKTPPEGFKCP 178 >XP_010436582.1 PREDICTED: 36.4 kDa proline-rich protein-like, partial [Camelina sativa] Length = 230 Score = 65.9 bits (159), Expect = 4e-11 Identities = 26/40 (65%), Positives = 33/40 (82%) Frame = +3 Query: 3 ALCLCTVIKANLLNLDIYVPLALELLASCQKTPPKGFTCP 122 A+CLCT I+A LLN+D+ +P+ALELL C KTPP+GF CP Sbjct: 180 AICLCTTIRAKLLNIDLVIPIALELLVDCGKTPPRGFKCP 219 >XP_006380877.1 hypothetical protein POPTR_0006s01020g [Populus trichocarpa] ERP58674.1 hypothetical protein POPTR_0006s01020g [Populus trichocarpa] Length = 184 Score = 65.1 bits (157), Expect = 4e-11 Identities = 27/40 (67%), Positives = 34/40 (85%) Frame = +3 Query: 3 ALCLCTVIKANLLNLDIYVPLALELLASCQKTPPKGFTCP 122 A+CLCTVIKA LLN+++ +P+ALELL C KTPP+GF CP Sbjct: 144 AVCLCTVIKAKLLNINLILPIALELLVDCGKTPPEGFKCP 183 >XP_006855688.1 PREDICTED: 36.4 kDa proline-rich protein [Amborella trichopoda] ERN17155.1 hypothetical protein AMTR_s00044p00134830 [Amborella trichopoda] Length = 275 Score = 66.2 bits (160), Expect = 5e-11 Identities = 28/41 (68%), Positives = 35/41 (85%) Frame = +3 Query: 3 ALCLCTVIKANLLNLDIYVPLALELLASCQKTPPKGFTCPK 125 ALCLCT IK LLNL+I++P+ALELL +C K+PP GFTCP+ Sbjct: 234 ALCLCTTIKLKLLNLNIFLPIALELLITCGKSPPPGFTCPQ 274 >JAT44226.1 36. proline-rich protein [Anthurium amnicola] Length = 216 Score = 65.5 bits (158), Expect = 5e-11 Identities = 27/39 (69%), Positives = 34/39 (87%) Frame = +3 Query: 3 ALCLCTVIKANLLNLDIYVPLALELLASCQKTPPKGFTC 119 A+CLCT IK LLNLDI++P+AL+LLA+C KTPP G+TC Sbjct: 176 AVCLCTTIKLKLLNLDIFIPIALKLLATCGKTPPPGYTC 214 >XP_006286225.1 hypothetical protein CARUB_v10007792mg [Capsella rubella] EOA19123.1 hypothetical protein CARUB_v10007792mg [Capsella rubella] Length = 248 Score = 65.9 bits (159), Expect = 5e-11 Identities = 27/40 (67%), Positives = 33/40 (82%) Frame = +3 Query: 3 ALCLCTVIKANLLNLDIYVPLALELLASCQKTPPKGFTCP 122 A+CLCT I+A LLN+D+ VP+ALELL C KTPP+GF CP Sbjct: 199 AVCLCTTIRAKLLNIDLIVPIALELLVDCGKTPPRGFKCP 238 >XP_003525816.1 PREDICTED: 36.4 kDa proline-rich protein-like [Glycine max] KHN04349.1 36.4 kDa proline-rich protein [Glycine soja] KRH57376.1 hypothetical protein GLYMA_05G057600 [Glycine max] Length = 179 Score = 64.7 bits (156), Expect = 6e-11 Identities = 26/40 (65%), Positives = 34/40 (85%) Frame = +3 Query: 3 ALCLCTVIKANLLNLDIYVPLALELLASCQKTPPKGFTCP 122 A+CLCTVI+A LLNL I++P+AL++L +C KTPP GF CP Sbjct: 137 AICLCTVIRAKLLNLSIFLPIALQVLVTCGKTPPPGFVCP 176 >XP_004516835.2 PREDICTED: 36.4 kDa proline-rich protein-like [Cicer arietinum] Length = 164 Score = 64.3 bits (155), Expect = 6e-11 Identities = 27/40 (67%), Positives = 34/40 (85%) Frame = +3 Query: 3 ALCLCTVIKANLLNLDIYVPLALELLASCQKTPPKGFTCP 122 A+CLCTVI+A LLNL+I++PLAL+LL +C K PP GF CP Sbjct: 123 AICLCTVIRAKLLNLNIFLPLALQLLITCGKNPPPGFLCP 162 >XP_011002407.1 PREDICTED: 36.4 kDa proline-rich protein isoform X3 [Populus euphratica] Length = 180 Score = 64.3 bits (155), Expect = 8e-11 Identities = 27/40 (67%), Positives = 33/40 (82%) Frame = +3 Query: 3 ALCLCTVIKANLLNLDIYVPLALELLASCQKTPPKGFTCP 122 A CLCTVIKA LLN+++ +P+ALE+LA C KTPP GF CP Sbjct: 140 ASCLCTVIKAKLLNINLIIPIALEVLADCGKTPPPGFKCP 179