BLASTX nr result
ID: Angelica27_contig00023439
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00023439 (366 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017232603.1 PREDICTED: beta-mannosyltransferase 2-like [Daucu... 54 2e-06 >XP_017232603.1 PREDICTED: beta-mannosyltransferase 2-like [Daucus carota subsp. sativus] KZN06908.1 hypothetical protein DCAR_007745 [Daucus carota subsp. sativus] Length = 162 Score = 53.9 bits (128), Expect = 2e-06 Identities = 27/38 (71%), Positives = 30/38 (78%) Frame = -3 Query: 154 MMQTLQQVPGPISGSLSFNGNLSKXXXXEMSKSALSTF 41 MMQT QQ PGP+S S SFNGNL+K E+SKSALSTF Sbjct: 1 MMQTQQQAPGPVSQSFSFNGNLTKEEEEELSKSALSTF 38