BLASTX nr result
ID: Angelica27_contig00023349
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00023349 (395 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KZM94000.1 hypothetical protein DCAR_017245 [Daucus carota subsp... 65 7e-10 >KZM94000.1 hypothetical protein DCAR_017245 [Daucus carota subsp. sativus] Length = 592 Score = 65.5 bits (158), Expect = 7e-10 Identities = 28/35 (80%), Positives = 30/35 (85%) Frame = +3 Query: 57 RSQFGLLAPVCNGCEPTSVDFMYKEIQCIGLTGDV 161 +SQFGLLAPVC GCEPTSV FMYKE QCIG TG + Sbjct: 178 KSQFGLLAPVCKGCEPTSVAFMYKETQCIGFTGQI 212