BLASTX nr result
ID: Angelica27_contig00023301
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00023301 (480 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017215003.1 PREDICTED: pentatricopeptide repeat-containing pr... 170 4e-46 >XP_017215003.1 PREDICTED: pentatricopeptide repeat-containing protein At4g30825, chloroplastic [Daucus carota subsp. sativus] KZM92548.1 hypothetical protein DCAR_020087 [Daucus carota subsp. sativus] Length = 894 Score = 170 bits (430), Expect = 4e-46 Identities = 84/107 (78%), Positives = 98/107 (91%), Gaps = 1/107 (0%) Frame = +1 Query: 163 MAAIKFASLVESNDTHKLNFNGYVHTTAAFMIIPFSKLKNIRVSRLDNLELSEPVLDKAS 342 MAAIKFASLVESND KL+F+GYVHT + F++IPFSKLK+IRVSRLDN+ELS+PVL+KAS Sbjct: 1 MAAIKFASLVESNDAQKLSFSGYVHTASVFVVIPFSKLKSIRVSRLDNVELSDPVLEKAS 60 Query: 343 KFSSEFKKGKRNIWMRFRDLSKVKDLSSSERNDAKGENGE-GPVLCD 480 KFSSEFKKGKRNIWMRFR LSKVK+L+S RN+AKG+NGE G +LCD Sbjct: 61 KFSSEFKKGKRNIWMRFRSLSKVKELTSDGRNEAKGKNGETGVLLCD 107