BLASTX nr result
ID: Angelica27_contig00023244
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00023244 (286 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ADE77519.1 unknown [Picea sitchensis] 124 4e-33 ABK26281.1 unknown [Picea sitchensis] 123 1e-32 XP_009593525.1 PREDICTED: multiple organellar RNA editing factor... 112 1e-27 XP_004248249.1 PREDICTED: multiple organellar RNA editing factor... 112 1e-27 XP_015056086.1 PREDICTED: multiple organellar RNA editing factor... 112 2e-27 XP_006358943.1 PREDICTED: multiple organellar RNA editing factor... 112 2e-27 XP_006360053.1 PREDICTED: multiple organellar RNA editing factor... 112 2e-27 XP_015059208.1 PREDICTED: multiple organellar RNA editing factor... 112 2e-27 XP_008355406.1 PREDICTED: multiple organellar RNA editing factor... 108 2e-27 XP_004251891.1 PREDICTED: multiple organellar RNA editing factor... 112 2e-27 XP_015059207.1 PREDICTED: multiple organellar RNA editing factor... 112 2e-27 XP_011098243.1 PREDICTED: uncharacterized protein At3g15000, mit... 112 2e-27 XP_016541633.1 PREDICTED: multiple organellar RNA editing factor... 112 3e-27 XP_016483847.1 PREDICTED: multiple organellar RNA editing factor... 111 4e-27 XP_016468596.1 PREDICTED: multiple organellar RNA editing factor... 111 4e-27 XP_009803761.1 PREDICTED: uncharacterized protein At3g15000, mit... 111 4e-27 XP_009620767.1 PREDICTED: multiple organellar RNA editing factor... 111 4e-27 XP_009801659.1 PREDICTED: uncharacterized protein At3g15000, mit... 111 5e-27 XP_018632006.1 PREDICTED: multiple organellar RNA editing factor... 111 5e-27 EAZ09699.1 hypothetical protein OsI_31983 [Oryza sativa Indica G... 109 5e-27 >ADE77519.1 unknown [Picea sitchensis] Length = 280 Score = 124 bits (312), Expect = 4e-33 Identities = 55/56 (98%), Positives = 56/56 (100%) Frame = +2 Query: 2 TKSYGGEPFINGQAVPYDPKYHEEWVRNNARCNERRSNDRPRNFDRSRNFERRREM 169 TKSYGGEPFINGQAVPYDPKYHE+WVRNNARCNERRSNDRPRNFDRSRNFERRREM Sbjct: 184 TKSYGGEPFINGQAVPYDPKYHEDWVRNNARCNERRSNDRPRNFDRSRNFERRREM 239 >ABK26281.1 unknown [Picea sitchensis] Length = 274 Score = 123 bits (308), Expect = 1e-32 Identities = 54/56 (96%), Positives = 55/56 (98%) Frame = +2 Query: 2 TKSYGGEPFINGQAVPYDPKYHEEWVRNNARCNERRSNDRPRNFDRSRNFERRREM 169 TK YGGEPFINGQAVPYDPKYHE+WVRNNARCNERRSNDRPRNFDRSRNFERRREM Sbjct: 187 TKDYGGEPFINGQAVPYDPKYHEDWVRNNARCNERRSNDRPRNFDRSRNFERRREM 242 >XP_009593525.1 PREDICTED: multiple organellar RNA editing factor 8, chloroplastic/mitochondrial [Nicotiana tomentosiformis] XP_016473240.1 PREDICTED: multiple organellar RNA editing factor 8, chloroplastic/mitochondrial-like [Nicotiana tabacum] Length = 381 Score = 112 bits (280), Expect = 1e-27 Identities = 52/56 (92%), Positives = 52/56 (92%), Gaps = 1/56 (1%) Frame = +2 Query: 5 KSYGGEPFINGQAVPYDPKYHEEWVRNNARCNER-RSNDRPRNFDRSRNFERRREM 169 K YGGEPFINGQAVPYDPKYHEEWVRNNAR NER R NDRPRNFDRSRNFERRREM Sbjct: 179 KDYGGEPFINGQAVPYDPKYHEEWVRNNARANERNRRNDRPRNFDRSRNFERRREM 234 >XP_004248249.1 PREDICTED: multiple organellar RNA editing factor 8, chloroplastic/mitochondrial [Solanum lycopersicum] Length = 391 Score = 112 bits (280), Expect = 1e-27 Identities = 52/56 (92%), Positives = 52/56 (92%), Gaps = 1/56 (1%) Frame = +2 Query: 5 KSYGGEPFINGQAVPYDPKYHEEWVRNNARCNER-RSNDRPRNFDRSRNFERRREM 169 K YGGEPFINGQAVPYDPKYHEEWVRNNAR NER R NDRPRNFDRSRNFERRREM Sbjct: 179 KDYGGEPFINGQAVPYDPKYHEEWVRNNARANERNRRNDRPRNFDRSRNFERRREM 234 >XP_015056086.1 PREDICTED: multiple organellar RNA editing factor 8, chloroplastic/mitochondrial-like [Solanum pennellii] Length = 401 Score = 112 bits (280), Expect = 2e-27 Identities = 52/56 (92%), Positives = 52/56 (92%), Gaps = 1/56 (1%) Frame = +2 Query: 5 KSYGGEPFINGQAVPYDPKYHEEWVRNNARCNER-RSNDRPRNFDRSRNFERRREM 169 K YGGEPFINGQAVPYDPKYHEEWVRNNAR NER R NDRPRNFDRSRNFERRREM Sbjct: 179 KDYGGEPFINGQAVPYDPKYHEEWVRNNARANERNRRNDRPRNFDRSRNFERRREM 234 >XP_006358943.1 PREDICTED: multiple organellar RNA editing factor 8, chloroplastic/mitochondrial-like [Solanum tuberosum] Length = 403 Score = 112 bits (280), Expect = 2e-27 Identities = 52/56 (92%), Positives = 52/56 (92%), Gaps = 1/56 (1%) Frame = +2 Query: 5 KSYGGEPFINGQAVPYDPKYHEEWVRNNARCNER-RSNDRPRNFDRSRNFERRREM 169 K YGGEPFINGQAVPYDPKYHEEWVRNNAR NER R NDRPRNFDRSRNFERRREM Sbjct: 171 KDYGGEPFINGQAVPYDPKYHEEWVRNNARANERNRRNDRPRNFDRSRNFERRREM 226 >XP_006360053.1 PREDICTED: multiple organellar RNA editing factor 8, chloroplastic/mitochondrial-like [Solanum tuberosum] Length = 411 Score = 112 bits (280), Expect = 2e-27 Identities = 52/56 (92%), Positives = 52/56 (92%), Gaps = 1/56 (1%) Frame = +2 Query: 5 KSYGGEPFINGQAVPYDPKYHEEWVRNNARCNER-RSNDRPRNFDRSRNFERRREM 169 K YGGEPFINGQAVPYDPKYHEEWVRNNAR NER R NDRPRNFDRSRNFERRREM Sbjct: 179 KDYGGEPFINGQAVPYDPKYHEEWVRNNARANERNRRNDRPRNFDRSRNFERRREM 234 >XP_015059208.1 PREDICTED: multiple organellar RNA editing factor 8, chloroplastic/mitochondrial isoform X2 [Solanum pennellii] XP_015059209.1 PREDICTED: multiple organellar RNA editing factor 8, chloroplastic/mitochondrial isoform X3 [Solanum pennellii] Length = 413 Score = 112 bits (280), Expect = 2e-27 Identities = 52/56 (92%), Positives = 52/56 (92%), Gaps = 1/56 (1%) Frame = +2 Query: 5 KSYGGEPFINGQAVPYDPKYHEEWVRNNARCNER-RSNDRPRNFDRSRNFERRREM 169 K YGGEPFINGQAVPYDPKYHEEWVRNNAR NER R NDRPRNFDRSRNFERRREM Sbjct: 171 KDYGGEPFINGQAVPYDPKYHEEWVRNNARANERNRRNDRPRNFDRSRNFERRREM 226 >XP_008355406.1 PREDICTED: multiple organellar RNA editing factor 8, chloroplastic/mitochondrial-like [Malus domestica] Length = 241 Score = 108 bits (271), Expect = 2e-27 Identities = 49/55 (89%), Positives = 51/55 (92%), Gaps = 1/55 (1%) Frame = +2 Query: 5 KSYGGEPFINGQAVPYDPKYHEEWVRNNARCNER-RSNDRPRNFDRSRNFERRRE 166 K YGGEPFINGQAVPYDPKYHEEW+RNN+R NER R NDRPRNFDRSRNFERRRE Sbjct: 78 KDYGGEPFINGQAVPYDPKYHEEWIRNNSRANERNRRNDRPRNFDRSRNFERRRE 132 >XP_004251891.1 PREDICTED: multiple organellar RNA editing factor 8, chloroplastic/mitochondrial [Solanum lycopersicum] Length = 429 Score = 112 bits (280), Expect = 2e-27 Identities = 52/56 (92%), Positives = 52/56 (92%), Gaps = 1/56 (1%) Frame = +2 Query: 5 KSYGGEPFINGQAVPYDPKYHEEWVRNNARCNER-RSNDRPRNFDRSRNFERRREM 169 K YGGEPFINGQAVPYDPKYHEEWVRNNAR NER R NDRPRNFDRSRNFERRREM Sbjct: 171 KDYGGEPFINGQAVPYDPKYHEEWVRNNARANERNRRNDRPRNFDRSRNFERRREM 226 >XP_015059207.1 PREDICTED: multiple organellar RNA editing factor 8, chloroplastic/mitochondrial isoform X1 [Solanum pennellii] Length = 438 Score = 112 bits (280), Expect = 2e-27 Identities = 52/56 (92%), Positives = 52/56 (92%), Gaps = 1/56 (1%) Frame = +2 Query: 5 KSYGGEPFINGQAVPYDPKYHEEWVRNNARCNER-RSNDRPRNFDRSRNFERRREM 169 K YGGEPFINGQAVPYDPKYHEEWVRNNAR NER R NDRPRNFDRSRNFERRREM Sbjct: 171 KDYGGEPFINGQAVPYDPKYHEEWVRNNARANERNRRNDRPRNFDRSRNFERRREM 226 >XP_011098243.1 PREDICTED: uncharacterized protein At3g15000, mitochondrial [Sesamum indicum] Length = 440 Score = 112 bits (280), Expect = 2e-27 Identities = 52/56 (92%), Positives = 52/56 (92%), Gaps = 1/56 (1%) Frame = +2 Query: 5 KSYGGEPFINGQAVPYDPKYHEEWVRNNARCNER-RSNDRPRNFDRSRNFERRREM 169 K YGGEPFINGQAVPYDPKYHEEWVRNNAR NER R NDRPRNFDRSRNFERRREM Sbjct: 182 KDYGGEPFINGQAVPYDPKYHEEWVRNNARANERNRRNDRPRNFDRSRNFERRREM 237 >XP_016541633.1 PREDICTED: multiple organellar RNA editing factor 8, chloroplastic/mitochondrial-like [Capsicum annuum] Length = 451 Score = 112 bits (280), Expect = 3e-27 Identities = 52/56 (92%), Positives = 52/56 (92%), Gaps = 1/56 (1%) Frame = +2 Query: 5 KSYGGEPFINGQAVPYDPKYHEEWVRNNARCNER-RSNDRPRNFDRSRNFERRREM 169 K YGGEPFINGQAVPYDPKYHEEWVRNNAR NER R NDRPRNFDRSRNFERRREM Sbjct: 162 KDYGGEPFINGQAVPYDPKYHEEWVRNNARANERNRRNDRPRNFDRSRNFERRREM 217 >XP_016483847.1 PREDICTED: multiple organellar RNA editing factor 8, chloroplastic/mitochondrial-like [Nicotiana tabacum] Length = 396 Score = 111 bits (277), Expect = 4e-27 Identities = 51/56 (91%), Positives = 52/56 (92%), Gaps = 1/56 (1%) Frame = +2 Query: 5 KSYGGEPFINGQAVPYDPKYHEEWVRNNARCNER-RSNDRPRNFDRSRNFERRREM 169 K YGGEPFINGQAVPYDPKYHEEWVRNNAR NER R NDRPRNFDRSRNFERRR+M Sbjct: 176 KDYGGEPFINGQAVPYDPKYHEEWVRNNARANERNRRNDRPRNFDRSRNFERRRDM 231 >XP_016468596.1 PREDICTED: multiple organellar RNA editing factor 8, chloroplastic/mitochondrial-like [Nicotiana tabacum] Length = 397 Score = 111 bits (277), Expect = 4e-27 Identities = 51/56 (91%), Positives = 52/56 (92%), Gaps = 1/56 (1%) Frame = +2 Query: 5 KSYGGEPFINGQAVPYDPKYHEEWVRNNARCNER-RSNDRPRNFDRSRNFERRREM 169 K YGGEPFINGQAVPYDPKYHEEWVRNNAR NE+ R NDRPRNFDRSRNFERRREM Sbjct: 179 KDYGGEPFINGQAVPYDPKYHEEWVRNNARANEKNRRNDRPRNFDRSRNFERRREM 234 >XP_009803761.1 PREDICTED: uncharacterized protein At3g15000, mitochondrial-like [Nicotiana sylvestris] Length = 397 Score = 111 bits (277), Expect = 4e-27 Identities = 51/56 (91%), Positives = 52/56 (92%), Gaps = 1/56 (1%) Frame = +2 Query: 5 KSYGGEPFINGQAVPYDPKYHEEWVRNNARCNER-RSNDRPRNFDRSRNFERRREM 169 K YGGEPFINGQAVPYDPKYHEEWVRNNAR NE+ R NDRPRNFDRSRNFERRREM Sbjct: 179 KDYGGEPFINGQAVPYDPKYHEEWVRNNARANEKNRRNDRPRNFDRSRNFERRREM 234 >XP_009620767.1 PREDICTED: multiple organellar RNA editing factor 8, chloroplastic/mitochondrial isoform X4 [Nicotiana tomentosiformis] Length = 403 Score = 111 bits (277), Expect = 4e-27 Identities = 51/56 (91%), Positives = 52/56 (92%), Gaps = 1/56 (1%) Frame = +2 Query: 5 KSYGGEPFINGQAVPYDPKYHEEWVRNNARCNER-RSNDRPRNFDRSRNFERRREM 169 K YGGEPFINGQAVPYDPKYHEEWVRNNAR NER R NDRPRNFDRSRNFERRR+M Sbjct: 176 KDYGGEPFINGQAVPYDPKYHEEWVRNNARANERNRRNDRPRNFDRSRNFERRRDM 231 >XP_009801659.1 PREDICTED: uncharacterized protein At3g15000, mitochondrial [Nicotiana sylvestris] Length = 410 Score = 111 bits (277), Expect = 5e-27 Identities = 51/56 (91%), Positives = 52/56 (92%), Gaps = 1/56 (1%) Frame = +2 Query: 5 KSYGGEPFINGQAVPYDPKYHEEWVRNNARCNER-RSNDRPRNFDRSRNFERRREM 169 K YGGEPFINGQAVPYDPKYHEEWVRNNAR NER R NDRPRNFDRSRNFERRR+M Sbjct: 176 KDYGGEPFINGQAVPYDPKYHEEWVRNNARANERNRRNDRPRNFDRSRNFERRRDM 231 >XP_018632006.1 PREDICTED: multiple organellar RNA editing factor 8, chloroplastic/mitochondrial isoform X3 [Nicotiana tomentosiformis] Length = 418 Score = 111 bits (277), Expect = 5e-27 Identities = 51/56 (91%), Positives = 52/56 (92%), Gaps = 1/56 (1%) Frame = +2 Query: 5 KSYGGEPFINGQAVPYDPKYHEEWVRNNARCNER-RSNDRPRNFDRSRNFERRREM 169 K YGGEPFINGQAVPYDPKYHEEWVRNNAR NER R NDRPRNFDRSRNFERRR+M Sbjct: 176 KDYGGEPFINGQAVPYDPKYHEEWVRNNARANERNRRNDRPRNFDRSRNFERRRDM 231 >EAZ09699.1 hypothetical protein OsI_31983 [Oryza sativa Indica Group] Length = 306 Score = 109 bits (272), Expect = 5e-27 Identities = 50/55 (90%), Positives = 51/55 (92%), Gaps = 1/55 (1%) Frame = +2 Query: 5 KSYGGEPFINGQAVPYDPKYHEEWVRNNARCNER-RSNDRPRNFDRSRNFERRRE 166 K YGGEPFING+AVPYDPKYHEEWVRNNAR NER R NDRPRNFDRSRNFERRRE Sbjct: 85 KDYGGEPFINGEAVPYDPKYHEEWVRNNARANERSRRNDRPRNFDRSRNFERRRE 139