BLASTX nr result
ID: Angelica27_contig00023217
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00023217 (458 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017217414.1 PREDICTED: uncharacterized protein LOC108194991 [... 67 1e-19 KZN04262.1 hypothetical protein DCAR_005096 [Daucus carota subsp... 55 4e-06 >XP_017217414.1 PREDICTED: uncharacterized protein LOC108194991 [Daucus carota subsp. sativus] Length = 173 Score = 66.6 bits (161), Expect(3) = 1e-19 Identities = 30/39 (76%), Positives = 36/39 (92%) Frame = -3 Query: 348 VQEEVDAQVNRKVQENLTLVLQKLAKANPGIMFNIEDFC 232 VQEEVDAQVN+KVQ+NLTL L+K+A+ANPGI N+EDFC Sbjct: 116 VQEEVDAQVNKKVQQNLTLALKKIAEANPGIKINMEDFC 154 Score = 53.5 bits (127), Expect(3) = 1e-19 Identities = 25/34 (73%), Positives = 29/34 (85%) Frame = -2 Query: 454 GKKHGPAWLHGRCPNAAKVCRSTSGSTNTYVQEL 353 GKKHG WL+GRCPNAAKV RSTS S N+YV++L Sbjct: 64 GKKHGKTWLYGRCPNAAKVPRSTS-SGNSYVEDL 96 Score = 23.1 bits (48), Expect(3) = 1e-19 Identities = 9/11 (81%), Positives = 10/11 (90%) Frame = -1 Query: 224 SSDD*NGTPVT 192 SSDD NGTP+T Sbjct: 158 SSDDENGTPIT 168 >KZN04262.1 hypothetical protein DCAR_005096 [Daucus carota subsp. sativus] Length = 409 Score = 55.5 bits (132), Expect = 4e-06 Identities = 25/39 (64%), Positives = 33/39 (84%) Frame = -3 Query: 348 VQEEVDAQVNRKVQENLTLVLQKLAKANPGIMFNIEDFC 232 VQ+EVDA+VN+KVQENL+ VL+KL +ANPGI N+ + C Sbjct: 346 VQDEVDAKVNKKVQENLSWVLKKLGEANPGINVNLAELC 384