BLASTX nr result
ID: Angelica27_contig00023054
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00023054 (532 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KZN08013.1 hypothetical protein DCAR_000682 [Daucus carota subsp... 117 2e-27 XP_017244284.1 PREDICTED: ubiquitin carboxyl-terminal hydrolase ... 117 2e-27 >KZN08013.1 hypothetical protein DCAR_000682 [Daucus carota subsp. sativus] Length = 871 Score = 117 bits (294), Expect = 2e-27 Identities = 59/74 (79%), Positives = 63/74 (85%) Frame = -1 Query: 532 NPDGKPKELEIEKGSLSLSVTKDVSAGGKDGQKFSGLKSKPLLRPGFLGKHPREKYSKQA 353 N DGKPK+LEI K SL+L V KDVSAGGKDG+K SG +SKPLLRPGFLGKHPREKYSKQ Sbjct: 758 NSDGKPKKLEINKDSLALPVNKDVSAGGKDGRKHSGSESKPLLRPGFLGKHPREKYSKQE 817 Query: 352 AVVPAGISNASFNS 311 AVVPA I NAS NS Sbjct: 818 AVVPAEIGNASSNS 831 >XP_017244284.1 PREDICTED: ubiquitin carboxyl-terminal hydrolase 18 [Daucus carota subsp. sativus] Length = 906 Score = 117 bits (294), Expect = 2e-27 Identities = 59/74 (79%), Positives = 63/74 (85%) Frame = -1 Query: 532 NPDGKPKELEIEKGSLSLSVTKDVSAGGKDGQKFSGLKSKPLLRPGFLGKHPREKYSKQA 353 N DGKPK+LEI K SL+L V KDVSAGGKDG+K SG +SKPLLRPGFLGKHPREKYSKQ Sbjct: 793 NSDGKPKKLEINKDSLALPVNKDVSAGGKDGRKHSGSESKPLLRPGFLGKHPREKYSKQE 852 Query: 352 AVVPAGISNASFNS 311 AVVPA I NAS NS Sbjct: 853 AVVPAEIGNASSNS 866