BLASTX nr result
ID: Angelica27_contig00022954
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00022954 (313 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017231327.1 PREDICTED: protein pleiotropic regulatory locus 1... 61 9e-09 XP_012843716.1 PREDICTED: protein pleiotropic regulatory locus 1... 61 1e-08 KZV14684.1 protein pleiotropic regulatory locus 1-like [Dorcocer... 59 8e-08 XP_011092075.1 PREDICTED: protein pleiotropic regulatory locus 1... 58 1e-07 XP_019159623.1 PREDICTED: protein pleiotropic regulatory locus 1... 55 9e-07 XP_019239791.1 PREDICTED: protein pleiotropic regulatory locus 1... 55 2e-06 XP_009763088.1 PREDICTED: protein pleiotropic regulatory locus 1... 55 2e-06 XP_009596265.1 PREDICTED: protein pleiotropic regulatory locus 1... 55 2e-06 XP_012492669.1 PREDICTED: protein pleiotropic regulatory locus 1... 51 2e-06 KVH97238.1 G-protein beta WD-40 repeat-containing protein [Cynar... 54 2e-06 XP_009352282.1 PREDICTED: protein pleiotropic regulatory locus 1... 54 2e-06 XP_008390645.1 PREDICTED: protein pleiotropic regulatory locus 1... 54 2e-06 JAT57844.1 Protein pleiotropic regulatory locus 1 [Anthurium amn... 54 2e-06 KDO71702.1 hypothetical protein CISIN_1g011457mg [Citrus sinensis] 54 3e-06 XP_006489059.1 PREDICTED: protein pleiotropic regulatory locus 1... 54 3e-06 XP_006419550.1 hypothetical protein CICLE_v10004853mg [Citrus cl... 54 3e-06 GAU36083.1 hypothetical protein TSUD_320500 [Trifolium subterran... 54 4e-06 XP_013463226.1 PP1/PP2A phosphatase pleiotropic regulator PRL1 [... 54 4e-06 XP_015062528.1 PREDICTED: protein pleiotropic regulatory locus 1... 54 4e-06 XP_012482120.1 PREDICTED: protein pleiotropic regulatory locus 1... 54 4e-06 >XP_017231327.1 PREDICTED: protein pleiotropic regulatory locus 1-like [Daucus carota subsp. sativus] KZN07769.1 hypothetical protein DCAR_008606 [Daucus carota subsp. sativus] Length = 479 Score = 61.2 bits (147), Expect = 9e-09 Identities = 30/45 (66%), Positives = 32/45 (71%) Frame = -2 Query: 135 LPVEPQXXXXXXXXXXKRTLDLFSPSHSQFPPPDPESKKIRWRYK 1 LPVEPQ KR LDLF+PSHSQFPPP+PESKKIR YK Sbjct: 5 LPVEPQSLKKLSFKSLKRALDLFAPSHSQFPPPNPESKKIRLSYK 49 >XP_012843716.1 PREDICTED: protein pleiotropic regulatory locus 1 isoform X1 [Erythranthe guttata] EYU32108.1 hypothetical protein MIMGU_mgv1a005488mg [Erythranthe guttata] Length = 482 Score = 60.8 bits (146), Expect = 1e-08 Identities = 29/45 (64%), Positives = 31/45 (68%) Frame = -2 Query: 135 LPVEPQXXXXXXXXXXKRTLDLFSPSHSQFPPPDPESKKIRWRYK 1 +PVEPQ KR LDLFSP+H QFPPPDPESKKIR YK Sbjct: 10 IPVEPQSLKKLSFKSVKRALDLFSPTHGQFPPPDPESKKIRVNYK 54 >KZV14684.1 protein pleiotropic regulatory locus 1-like [Dorcoceras hygrometricum] Length = 477 Score = 58.5 bits (140), Expect = 8e-08 Identities = 29/45 (64%), Positives = 30/45 (66%) Frame = -2 Query: 135 LPVEPQXXXXXXXXXXKRTLDLFSPSHSQFPPPDPESKKIRWRYK 1 LPVEPQ KR LDLFSP H QFPPPDPESKKIR +K Sbjct: 10 LPVEPQSLKKLGFKSLKRALDLFSPLHGQFPPPDPESKKIRVNHK 54 >XP_011092075.1 PREDICTED: protein pleiotropic regulatory locus 1 [Sesamum indicum] Length = 486 Score = 58.2 bits (139), Expect = 1e-07 Identities = 29/45 (64%), Positives = 30/45 (66%) Frame = -2 Query: 135 LPVEPQXXXXXXXXXXKRTLDLFSPSHSQFPPPDPESKKIRWRYK 1 LPVEPQ KR LDLFSP H QFPPPDPESKKIR +K Sbjct: 10 LPVEPQSIKKLSFKSMKRALDLFSPIHGQFPPPDPESKKIRVSHK 54 >XP_019159623.1 PREDICTED: protein pleiotropic regulatory locus 1-like [Ipomoea nil] Length = 480 Score = 55.5 bits (132), Expect = 9e-07 Identities = 27/45 (60%), Positives = 29/45 (64%) Frame = -2 Query: 135 LPVEPQXXXXXXXXXXKRTLDLFSPSHSQFPPPDPESKKIRWRYK 1 LPVEPQ KR LD+FSP H FPPPDPESKKIR +K Sbjct: 5 LPVEPQSLKKLSFKSLKRALDIFSPLHGHFPPPDPESKKIRISHK 49 >XP_019239791.1 PREDICTED: protein pleiotropic regulatory locus 1-like [Nicotiana attenuata] OIT20755.1 protein pleiotropic regulatory locus 1 [Nicotiana attenuata] Length = 483 Score = 54.7 bits (130), Expect = 2e-06 Identities = 27/43 (62%), Positives = 28/43 (65%) Frame = -2 Query: 129 VEPQXXXXXXXXXXKRTLDLFSPSHSQFPPPDPESKKIRWRYK 1 VEPQ KR+LDLFSP H FPPPDPESKKIR YK Sbjct: 13 VEPQSIKKLSFKSLKRSLDLFSPLHGHFPPPDPESKKIRTSYK 55 >XP_009763088.1 PREDICTED: protein pleiotropic regulatory locus 1-like [Nicotiana sylvestris] XP_016477163.1 PREDICTED: protein pleiotropic regulatory locus 1-like [Nicotiana tabacum] Length = 483 Score = 54.7 bits (130), Expect = 2e-06 Identities = 27/43 (62%), Positives = 28/43 (65%) Frame = -2 Query: 129 VEPQXXXXXXXXXXKRTLDLFSPSHSQFPPPDPESKKIRWRYK 1 VEPQ KR+LDLFSP H FPPPDPESKKIR YK Sbjct: 13 VEPQSIKKLSFKSLKRSLDLFSPLHGHFPPPDPESKKIRTSYK 55 >XP_009596265.1 PREDICTED: protein pleiotropic regulatory locus 1-like [Nicotiana tomentosiformis] XP_016490418.1 PREDICTED: protein pleiotropic regulatory locus 1-like [Nicotiana tabacum] Length = 483 Score = 54.7 bits (130), Expect = 2e-06 Identities = 27/43 (62%), Positives = 28/43 (65%) Frame = -2 Query: 129 VEPQXXXXXXXXXXKRTLDLFSPSHSQFPPPDPESKKIRWRYK 1 VEPQ KR+LDLFSP H FPPPDPESKKIR YK Sbjct: 13 VEPQSIKKLSFKSLKRSLDLFSPLHGHFPPPDPESKKIRTSYK 55 >XP_012492669.1 PREDICTED: protein pleiotropic regulatory locus 1-like [Gossypium raimondii] Length = 80 Score = 51.2 bits (121), Expect = 2e-06 Identities = 26/44 (59%), Positives = 28/44 (63%) Frame = -2 Query: 132 PVEPQXXXXXXXXXXKRTLDLFSPSHSQFPPPDPESKKIRWRYK 1 PVEPQ KRTLDLFSP H QF P+PESKKIR +K Sbjct: 10 PVEPQSLKKLSLKSLKRTLDLFSPIHGQFAAPNPESKKIRMSHK 53 >KVH97238.1 G-protein beta WD-40 repeat-containing protein [Cynara cardunculus var. scolymus] Length = 386 Score = 54.3 bits (129), Expect = 2e-06 Identities = 28/45 (62%), Positives = 29/45 (64%) Frame = -2 Query: 135 LPVEPQXXXXXXXXXXKRTLDLFSPSHSQFPPPDPESKKIRWRYK 1 LPVEPQ KR LDLFSP HSQ PPPD ESKKIR +K Sbjct: 10 LPVEPQSLKKLSFKSLKRALDLFSPLHSQLPPPDLESKKIRMSHK 54 >XP_009352282.1 PREDICTED: protein pleiotropic regulatory locus 1 [Pyrus x bretschneideri] Length = 480 Score = 54.3 bits (129), Expect = 2e-06 Identities = 25/44 (56%), Positives = 30/44 (68%) Frame = -2 Query: 132 PVEPQXXXXXXXXXXKRTLDLFSPSHSQFPPPDPESKKIRWRYK 1 PVEPQ KR+LDLFSP+H + PPPDPESK+IR +K Sbjct: 10 PVEPQSLKKLSLKSLKRSLDLFSPAHGELPPPDPESKRIRMSHK 53 >XP_008390645.1 PREDICTED: protein pleiotropic regulatory locus 1-like [Malus domestica] XP_008367145.1 PREDICTED: protein pleiotropic regulatory locus 1-like [Malus domestica] Length = 480 Score = 54.3 bits (129), Expect = 2e-06 Identities = 25/44 (56%), Positives = 30/44 (68%) Frame = -2 Query: 132 PVEPQXXXXXXXXXXKRTLDLFSPSHSQFPPPDPESKKIRWRYK 1 PVEPQ KR+LDLFSP+H + PPPDPESK+IR +K Sbjct: 10 PVEPQSLKKLSLKSLKRSLDLFSPAHGELPPPDPESKRIRMSHK 53 >JAT57844.1 Protein pleiotropic regulatory locus 1 [Anthurium amnicola] Length = 484 Score = 54.3 bits (129), Expect = 2e-06 Identities = 26/44 (59%), Positives = 29/44 (65%) Frame = -2 Query: 132 PVEPQXXXXXXXXXXKRTLDLFSPSHSQFPPPDPESKKIRWRYK 1 PVEPQ KR LDLFSP+H Q+ PPDPESK+IR YK Sbjct: 10 PVEPQSLKRLSLKSLKRALDLFSPTHGQYAPPDPESKRIRISYK 53 >KDO71702.1 hypothetical protein CISIN_1g011457mg [Citrus sinensis] Length = 485 Score = 53.9 bits (128), Expect = 3e-06 Identities = 26/44 (59%), Positives = 29/44 (65%) Frame = -2 Query: 132 PVEPQXXXXXXXXXXKRTLDLFSPSHSQFPPPDPESKKIRWRYK 1 PVEPQ KR LDLFSP+H + PPPDPESKKIR +K Sbjct: 10 PVEPQSLKKLSLKSQKRALDLFSPTHGRLPPPDPESKKIRISHK 53 >XP_006489059.1 PREDICTED: protein pleiotropic regulatory locus 1 [Citrus sinensis] Length = 485 Score = 53.9 bits (128), Expect = 3e-06 Identities = 26/44 (59%), Positives = 29/44 (65%) Frame = -2 Query: 132 PVEPQXXXXXXXXXXKRTLDLFSPSHSQFPPPDPESKKIRWRYK 1 PVEPQ KR LDLFSP+H + PPPDPESKKIR +K Sbjct: 10 PVEPQSLKKLSLKSQKRALDLFSPTHGRLPPPDPESKKIRISHK 53 >XP_006419550.1 hypothetical protein CICLE_v10004853mg [Citrus clementina] ESR32790.1 hypothetical protein CICLE_v10004853mg [Citrus clementina] Length = 485 Score = 53.9 bits (128), Expect = 3e-06 Identities = 26/44 (59%), Positives = 29/44 (65%) Frame = -2 Query: 132 PVEPQXXXXXXXXXXKRTLDLFSPSHSQFPPPDPESKKIRWRYK 1 PVEPQ KR LDLFSP+H + PPPDPESKKIR +K Sbjct: 10 PVEPQSLKKLSLKSQKRALDLFSPTHGRLPPPDPESKKIRISHK 53 >GAU36083.1 hypothetical protein TSUD_320500 [Trifolium subterraneum] Length = 480 Score = 53.5 bits (127), Expect = 4e-06 Identities = 27/44 (61%), Positives = 27/44 (61%) Frame = -2 Query: 132 PVEPQXXXXXXXXXXKRTLDLFSPSHSQFPPPDPESKKIRWRYK 1 PVEPQ KR LDLFSP H Q PPDPESKKIR YK Sbjct: 6 PVEPQSLKKLSFKSLKRALDLFSPLHQQLAPPDPESKKIRVNYK 49 >XP_013463226.1 PP1/PP2A phosphatase pleiotropic regulator PRL1 [Medicago truncatula] KEH37239.1 PP1/PP2A phosphatase pleiotropic regulator PRL1 [Medicago truncatula] Length = 480 Score = 53.5 bits (127), Expect = 4e-06 Identities = 27/44 (61%), Positives = 27/44 (61%) Frame = -2 Query: 132 PVEPQXXXXXXXXXXKRTLDLFSPSHSQFPPPDPESKKIRWRYK 1 PVEPQ KR LDLFSP H Q PPPD ESKKIR YK Sbjct: 6 PVEPQSLKKLSFKSLKRALDLFSPVHQQLPPPDAESKKIRVNYK 49 >XP_015062528.1 PREDICTED: protein pleiotropic regulatory locus 1-like [Solanum pennellii] Length = 482 Score = 53.5 bits (127), Expect = 4e-06 Identities = 27/44 (61%), Positives = 28/44 (63%) Frame = -2 Query: 132 PVEPQXXXXXXXXXXKRTLDLFSPSHSQFPPPDPESKKIRWRYK 1 PVEPQ KR+LDLFSP H FP PDPESKKIR YK Sbjct: 11 PVEPQSLKKLSFKSLKRSLDLFSPIHGHFPLPDPESKKIRTSYK 54 >XP_012482120.1 PREDICTED: protein pleiotropic regulatory locus 1 [Gossypium raimondii] KJB28655.1 hypothetical protein B456_005G060900 [Gossypium raimondii] Length = 486 Score = 53.5 bits (127), Expect = 4e-06 Identities = 27/44 (61%), Positives = 28/44 (63%) Frame = -2 Query: 132 PVEPQXXXXXXXXXXKRTLDLFSPSHSQFPPPDPESKKIRWRYK 1 PVEPQ KR LDLFSPSH QF PDPESKKIR +K Sbjct: 10 PVEPQSLKKLSLKSLKRALDLFSPSHGQFAAPDPESKKIRMSHK 53