BLASTX nr result
ID: Angelica27_contig00022930
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00022930 (307 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017215535.1 PREDICTED: pentatricopeptide repeat-containing pr... 91 2e-19 >XP_017215535.1 PREDICTED: pentatricopeptide repeat-containing protein At3g02650, mitochondrial [Daucus carota subsp. sativus] KZM87242.1 hypothetical protein DCAR_024376 [Daucus carota subsp. sativus] Length = 582 Score = 91.3 bits (225), Expect = 2e-19 Identities = 54/96 (56%), Positives = 68/96 (70%), Gaps = 5/96 (5%) Frame = -2 Query: 273 VAAAISRKSKLSGETLNLALHSQ--VLHYKPPKHHAFLAPQIVFQKNPRFFSQN---PFP 109 VAAAI+RKSKLSG L +ALHSQ VLH P K AFLAPQ++F ++PR+FSQ+ P Sbjct: 5 VAAAIARKSKLSGG-LCVALHSQPQVLHSIPSKTAAFLAPQLIFHQDPRYFSQDSSTPLS 63 Query: 108 NDAQMPQFEPLGSVEVGENDIFSDIFNDAHNVFDKM 1 ++AQ+PQFE G D+ DIF DAHNVFD++ Sbjct: 64 DEAQIPQFES----AFGGEDVKDDIFGDAHNVFDEL 95